P2X4 Recombinant Protein Antigen

Images

 
There are currently no images for P2X4 Protein (NBP1-92239PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

P2X4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human P2RX4.

Source: E. coli

Amino Acid Sequence: YCMKKRLYYREKKYKYVEDYEQGLASELDQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
P2RX4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-92239.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for P2X4 Recombinant Protein Antigen

  • ATP receptor
  • ATP-gated cation channel protein
  • P2RX4
  • P2X purinoceptor 4
  • P2X4
  • P2X4P2X receptor, subunit 4
  • P2X4R
  • purinergic receptor P2X, ligand-gated ion channel, 4
  • Purinergic receptor
  • purinoceptor P2X4

Background

The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel with high calcium permeability. The main pharmacological distinction between the members of the purinoceptor family is the relative sensitivity to the antagonists suramin and PPADS. The product of this gene has the lowest sensitivity for these antagonists. Multiple alternatively spliced transcript variants have been identified for this gene although their full-length natures have not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-20180
Species: Hu, Pm, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-19655
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-33848
Species: Hu
Applications: IHC,  IHC-P
NBP1-30565
Species: Hu, Rt
Applications: IHC-FrFl, IHC, IHC-Fr,  IHC-P, WB
NBP3-35187
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC,  IHC-P, IP, KD, WB
NBP3-48674
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
AF5866
Species: Hu
Applications: IHC, WB
NBP3-48734
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
NBP2-61664
Species: Hu, Rt
Applications: ELISA, Flow, IHC,  IHC-P, WB
DBD00
Species: Hu
Applications: ELISA
NBP1-78249
Species: Hu, Pm, Mu, Po, Pm, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NLS877
Species: Hu, Pm, Pm
Applications: ICC/IF, IHC,  IHC-P
NBP2-61760
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-81838
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-1028
Species: Ca, Eq, Fe, Hu, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KO, PEP-ELISA, WB

Publications for P2X4 Protein (NBP1-92239PEP) (0)

There are no publications for P2X4 Protein (NBP1-92239PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for P2X4 Protein (NBP1-92239PEP) (0)

There are no reviews for P2X4 Protein (NBP1-92239PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for P2X4 Protein (NBP1-92239PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional P2X4 Products

Research Areas for P2X4 Protein (NBP1-92239PEP)

Find related products by research area.

Blogs on P2X4

There are no specific blogs for P2X4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our P2X4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol P2RX4