p27/Kip1 Antibody (4B4-E6) [DyLight 755]

Images

 

Product Details

Summary
Product Discontinued
View other related p27/Kip1 Primary Antibodies

Order Details


    • Catalog Number
      H00001027-M01IR
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

p27/Kip1 Antibody (4B4-E6) [DyLight 755] Summary

Immunogen
CDKN1B (AAH01971, 1 a.a. - 198 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDGSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATGDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT
Specificity
CDKN1B - cyclin-dependent kinase inhibitor 1B (p27, Kip1)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CDKN1B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Proximity Ligation Assay

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for p27/Kip1 Antibody (4B4-E6) [DyLight 755]

  • CDKN1B
  • CDKN4
  • cyclin-dependent kinase inhibitor 1B (p27, Kip1)
  • cyclin-dependent kinase inhibitor 1B
  • Cyclin-dependent kinase inhibitor p27
  • Kip1
  • KIP1P27KIP1
  • MEN1B
  • MEN4
  • p27
  • p27Kip1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-15141
Species: Hu
Applications: WB
NBP1-80616
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-13387
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6897
Species: Hu, Mu
Applications: WB, IHC
H00056996-R01
Species: Hu
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-31308
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P

Publications for p27/Kip1 Antibody (H00001027-M01IR) (0)

There are no publications for p27/Kip1 Antibody (H00001027-M01IR).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for p27/Kip1 Antibody (H00001027-M01IR) (0)

There are no reviews for p27/Kip1 Antibody (H00001027-M01IR). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for p27/Kip1 Antibody (H00001027-M01IR) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional p27/Kip1 Products

Bioinformatics Tool for p27/Kip1 Antibody (H00001027-M01IR)

Discover related pathways, diseases and genes to p27/Kip1 Antibody (H00001027-M01IR). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for p27/Kip1 Antibody (H00001027-M01IR)

Discover more about diseases related to p27/Kip1 Antibody (H00001027-M01IR).
 

Pathways for p27/Kip1 Antibody (H00001027-M01IR)

View related products by pathway.

PTMs for p27/Kip1 Antibody (H00001027-M01IR)

Learn more about PTMs related to p27/Kip1 Antibody (H00001027-M01IR).
 

Research Areas for p27/Kip1 Antibody (H00001027-M01IR)

Find related products by research area.

Blogs on p27/Kip1

There are no specific blogs for p27/Kip1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our p27/Kip1 Antibody (4B4-E6) [DyLight 755] and receive a gift card or discount.

Bioinformatics

Gene Symbol CDKN1B
Entrez