p18INK4c/CDKN2C Antibody


Orthogonal Strategies: Western Blot: p18INK4c/CDKN2C Antibody [NBP1-87686] - Analysis in human cell lines HeLa and U-251MG. Corresponding RNA-seq data are presented for the same cell lines. Loading control: ...read more
Immunohistochemistry-Paraffin: p18INK4c/CDKN2C Antibody [NBP1-87686] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Western Blot: p18INK4c/CDKN2C Antibody [NBP1-87686] - Analysis in human cell line U-937 MG.
Immunohistochemistry-Paraffin: p18INK4c/CDKN2C Antibody [NBP1-87686] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: p18INK4c/CDKN2C Antibody [NBP1-87686] - Staining of human cerebral cortex shows moderate positivity in neuropil.
Immunohistochemistry-Paraffin: p18INK4c/CDKN2C Antibody [NBP1-87686] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: p18INK4c/CDKN2C Antibody [NBP1-87686] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

p18INK4c/CDKN2C Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: GNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDT
Specificity of human p18INK4c/CDKN2C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (99%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
HIER pH6 retrieval is recommended.
Positive Control
p18INK4c/CDKN2C Lysate (NBP2-64983)
Control Peptide
p18INK4c/CDKN2C Protein (NBP1-87686PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for p18INK4c/CDKN2C Antibody

  • CDK6 inhibitor p18
  • CDKN2C
  • CDKN6
  • cyclin-dependent inhibitor
  • cyclin-dependent kinase 4 inhibitor C
  • Cyclin-dependent kinase 6 inhibitor
  • cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4)
  • INK4Ccyclin-dependent kinase 6 inhibitor p18
  • p18
  • p18INK4c
  • p18-INK4C
  • p18-INK6


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, Flow, IHC
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Rt
Applications: WB, ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for p18INK4c/CDKN2C Antibody (NBP1-87686) (0)

There are no publications for p18INK4c/CDKN2C Antibody (NBP1-87686).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for p18INK4c/CDKN2C Antibody (NBP1-87686) (0)

There are no reviews for p18INK4c/CDKN2C Antibody (NBP1-87686). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for p18INK4c/CDKN2C Antibody (NBP1-87686) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional p18INK4c/CDKN2C Products

Bioinformatics Tool for p18INK4c/CDKN2C Antibody (NBP1-87686)

Discover related pathways, diseases and genes to p18INK4c/CDKN2C Antibody (NBP1-87686). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for p18INK4c/CDKN2C Antibody (NBP1-87686)

Discover more about diseases related to p18INK4c/CDKN2C Antibody (NBP1-87686).

Pathways for p18INK4c/CDKN2C Antibody (NBP1-87686)

View related products by pathway.

PTMs for p18INK4c/CDKN2C Antibody (NBP1-87686)

Learn more about PTMs related to p18INK4c/CDKN2C Antibody (NBP1-87686).

Research Areas for p18INK4c/CDKN2C Antibody (NBP1-87686)

Find related products by research area.

Blogs on p18INK4c/CDKN2C

There are no specific blogs for p18INK4c/CDKN2C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our p18INK4c/CDKN2C Antibody and receive a gift card or discount.


Gene Symbol CDKN2C