p16INK4a/CDKN2A Antibody


Western Blot: p16INK4a/CDKN2A Antibody [NBP2-84205] - Host: Rabbit. Target Name: CDKN2A. Sample Tissue: Human Jurkat Whole Cell. Antibody Dilution: 1.0ug/ml

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

p16INK4a/CDKN2A Antibody Summary

The immunogen is a synthetic peptide directed towards the middle region of human CDKN2A. Peptide sequence: GRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNC The peptide sequence for this immunogen was taken from within the described region.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified

Alternate Names for p16INK4a/CDKN2A Antibody

  • ARF
  • CDK4 inhibitor p16-INK4
  • CDK4I
  • CDKN2
  • CDKN2A
  • cell cycle negative regulator beta
  • CMM2P16-INK4A
  • Cyclin-dependent kinase 4 inhibitor A
  • cyclin-dependent kinase inhibitor 2A (melanoma, p16, inhibits CDK4)
  • cyclin-dependent kinase inhibitor 2A
  • INK4
  • INK4a
  • MLM
  • MLMP16INK4
  • MTS-1
  • MTS1P14
  • Multiple tumor suppressor 1
  • p14
  • p14ARF
  • p16
  • p16-INK4
  • p16INK4a
  • p16-INK4a
  • P19
  • p19ARF
  • TP16


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC
Species: Hu, Mu, Rt, Bv, Fe
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
Species: Hu
Applications: WB, IHC
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, RNAi, S-ELISA
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB

Publications for p16INK4a/CDKN2A Antibody (NBP2-84205) (0)

There are no publications for p16INK4a/CDKN2A Antibody (NBP2-84205).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for p16INK4a/CDKN2A Antibody (NBP2-84205) (0)

There are no reviews for p16INK4a/CDKN2A Antibody (NBP2-84205). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for p16INK4a/CDKN2A Antibody (NBP2-84205). (Showing 1 - 1 of 1 FAQ).

  1. Our customer asked us about NBP1-02905, which we lately found it discontinued. While checking its related products, there seems none. Would you please help confirm if there is any replacement available?
    • With regards to your question on our CDKN2A antibodies, we do supply a wide range of products, but you haven't specified which application you are referring to. Please go through this link (cyclin-dependent kinase inhibitor 2A) and choose the product that will suit your experiment and the species you are working with. Meanwhile it is important to keep in mind that CDKN2A generates several transcript variants which differ in their first exons.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional p16INK4a/CDKN2A Products

Bioinformatics Tool for p16INK4a/CDKN2A Antibody (NBP2-84205)

Discover related pathways, diseases and genes to p16INK4a/CDKN2A Antibody (NBP2-84205). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for p16INK4a/CDKN2A Antibody (NBP2-84205)

Discover more about diseases related to p16INK4a/CDKN2A Antibody (NBP2-84205).

Pathways for p16INK4a/CDKN2A Antibody (NBP2-84205)

View related products by pathway.

PTMs for p16INK4a/CDKN2A Antibody (NBP2-84205)

Learn more about PTMs related to p16INK4a/CDKN2A Antibody (NBP2-84205).

Research Areas for p16INK4a/CDKN2A Antibody (NBP2-84205)

Find related products by research area.

Blogs on p16INK4a/CDKN2A

There are no specific blogs for p16INK4a/CDKN2A, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our p16INK4a/CDKN2A Antibody and receive a gift card or discount.


Gene Symbol CDKN2A