p15INK4b/CDKN2B Recombinant Protein Antigen

Images

 
There are currently no images for p15INK4b/CDKN2B Protein (NBP2-38023PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

p15INK4b/CDKN2B Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CDKN2B.

Source: E. coli

Amino Acid Sequence: MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CDKN2B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38023.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for p15INK4b/CDKN2B Recombinant Protein Antigen

  • CDK4I
  • CDKN2B
  • cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4)
  • cyclin-dependent kinases 4 and 6 binding protein
  • INK4BCDK4B inhibitor
  • MTS2
  • MTS-2
  • MTS2CDK inhibitory protein
  • Multiple tumor suppressor 2
  • p14_CDK inhibitor
  • p14_INK4B
  • p14-INK4b
  • p15 CDK inhibitor
  • p15_INK4B
  • P15cyclin-dependent kinase 4 inhibitor B
  • p15INK4b
  • p15-INK4b
  • TP15

Background

The normal progression of cells through the cell cycle is under the control of the cyclin dependent protein kinases Cdk4 and Cdk6 which are subject to inhibition by the mitotic inhibitory protein, p16. An isolated member of the p16 family has been designated p15. p15 expression is upregulated approximately 30-fold in TGFbeta-treated human keratinocytes, suggesting that p15 may act as an effector of TGFbeta-mediated cell cycle arrest. The gene encoding p15 has been mapped to chromosome 9p21 at a position adjacent to the p16 gene at a site of frequent chromosomal abnormality in human tumors. It has been suggested that p15 may function as an effector of TGFbeta-mediated cell cycle arrest through inhibition of Cdk4 and Cdk6 kinases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-31308
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-46085
Species: Hu
Applications: IHC,  IHC-P, WB
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP3-12954
Species: Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF1555
Species: Hu
Applications: WB
MAB6495
Species: Hu
Applications: ICC, Simple Western, WB
NBP2-00776
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-82454
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
AF2065
Species: Mu
Applications: ICC, IHC, Simple Western, WB
NBP1-87430
Species: Hu
Applications: IHC,  IHC-P
NBP1-80965
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00010263-B01P
Species: Hu, Mu, Rt
Applications: WB
NBP1-71687
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
NBP1-90949
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-38023PEP
Species: Hu
Applications: AC

Publications for p15INK4b/CDKN2B Protein (NBP2-38023PEP) (0)

There are no publications for p15INK4b/CDKN2B Protein (NBP2-38023PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for p15INK4b/CDKN2B Protein (NBP2-38023PEP) (0)

There are no reviews for p15INK4b/CDKN2B Protein (NBP2-38023PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for p15INK4b/CDKN2B Protein (NBP2-38023PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional p15INK4b/CDKN2B Products

Research Areas for p15INK4b/CDKN2B Protein (NBP2-38023PEP)

Find related products by research area.

Blogs on p15INK4b/CDKN2B

There are no specific blogs for p15INK4b/CDKN2B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our p15INK4b/CDKN2B Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CDKN2B