p130 Antibody (DCS-211)

Images

 

Product Details

Summary
Product Discontinued
View other related p130 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-54515
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

p130 Antibody (DCS-211) Summary

Immunogen
This hybridoma was established by fusion of mouse myeloma cell NS-2 with Balb/c mouse splenocyte immunized with a peptide from RB2 (KRKRRNSGSSDSRSHQNSPTELNKDRTSRDSSPVMR).
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
RBL2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
  • Immunoprecipitation

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 50% Glycerol
Preservative
No Preservative
Concentration
1 mg/ml
Purity
Protein A purified

Alternate Names for p130 Antibody (DCS-211)

  • FLJ26459
  • P130
  • PRB2
  • Rb2
  • RBR-2
  • retinoblastoma-like 2 (p130)
  • retinoblastoma-like protein 2,130 kDa retinoblastoma-associated protein
  • Retinoblastoma-related protein 2

Background

p130 Cas (Crk-associated substrate) is a 120-130 kD docking protein and a central coordinator for tyrosine-kinase-based signaling related to cell adhesion. p130 Cas has been implicated in induction of cell migration, growth factor stimulation, cytokine receptor engagement, cardiovascular development, and actin filament assembly. p130 Cas is localized to focal adhesions and stress fibers. When unphosporylated, localizes in the cytoplasm; phosphorylation by FAK induces movement to membrane. p130 Cas is dephosphorylated by PTP-PEST, dephosphorylation blocks cell migration. p130 Cas has been reported to interact with v-Crk, v-Src, nephrocystin, PTK2B, CrkII and to form complexes with Fak1, CrkL, and Lyn kinase and to heterodimerize with CasL. The Poly6139 antibody recognizes the C-terminal region of human p130 Cas and has been shown to be useful for Western blotting. v-Crk, v-Src, nephrocystin, PTK2B, CrkII. Forms complexes with Fak1, CrkL, Lyn kinase; heterodimerizes with CasL

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33735
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56888
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
NBP2-00532
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-21374
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-67327
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-00776
Species: Hu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-26616
Species: Hu
Applications: WB, IP
NBP2-67899
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001434-M08
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1555
Species: Hu
Applications: WB
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
H00027065-M01
Species: Hu, Rt
Applications: WB, ELISA
NBP2-24459
Species: Hu, Mu, Rt, Ca, Ch, Pm, Rb, RM, Xp, Ze
Applications: WB, ICC/IF
NBP1-31308
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-54515
Species: Hu
Applications: WB, ICC/IF, IP

Publications for p130 Antibody (NBP1-54515) (0)

There are no publications for p130 Antibody (NBP1-54515).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for p130 Antibody (NBP1-54515) (0)

There are no reviews for p130 Antibody (NBP1-54515). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for p130 Antibody (NBP1-54515) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional p130 Products

Bioinformatics Tool for p130 Antibody (NBP1-54515)

Discover related pathways, diseases and genes to p130 Antibody (NBP1-54515). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for p130 Antibody (NBP1-54515)

Discover more about diseases related to p130 Antibody (NBP1-54515).
 

Pathways for p130 Antibody (NBP1-54515)

View related products by pathway.

PTMs for p130 Antibody (NBP1-54515)

Learn more about PTMs related to p130 Antibody (NBP1-54515).
 

Research Areas for p130 Antibody (NBP1-54515)

Find related products by research area.

Blogs on p130

There are no specific blogs for p130, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our p130 Antibody (DCS-211) and receive a gift card or discount.

Bioinformatics

Gene Symbol RBL2