OVOL2 Antibody

Images

 
Western Blot: OVOL2 Antibody [NBP1-88754] - Analysis in human cell line SCLC-21H.
Immunocytochemistry/ Immunofluorescence: OVOL2 Antibody [NBP1-88754] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: OVOL2 Antibody [NBP1-88754] - Staining of human cerebral cortex shows moderate nuclear membrane positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

OVOL2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QYAYKQRRDKLYVCEDCGYTGPTQEDLYLHVNSAHPGSSFLKKTSKKLAALLQGKLTSAHQENTSLSEEEERK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OVOL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
OVOL2 Protein (NBP1-88754PEP)
Publications
Read Publications using
NBP1-88754 in the following applications:

  • 1 publication
  • WB
    2 publications

Reactivity Notes

Mouse and rat reactivity reported in scientific literature (PMID: 26504231). Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for OVOL2 Antibody

  • bA504H3.3
  • hOvo2
  • ovo-like 2 (Drosophila)
  • transcription factor Ovo-like 2
  • Zinc finger protein 339EUROIMAGE566589
  • ZNF339

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89469
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-33169
Species: Hu, Mu
Applications: WB
AF1620
Species: Mu
Applications: WB, IHC
AF4377
Species: Hu, Mu
Applications: WB, ICC
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-86960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56042
Species: Hu
Applications: IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89929
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
H00011026-M01
Species: Hu
Applications: WB, ELISA
H00140856-T01
Species: Hu
NB100-78486
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-88754
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for OVOL2 Antibody (NBP1-88754)(5)

Reviews for OVOL2 Antibody (NBP1-88754) (0)

There are no reviews for OVOL2 Antibody (NBP1-88754). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for OVOL2 Antibody (NBP1-88754) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional OVOL2 Products

Bioinformatics Tool for OVOL2 Antibody (NBP1-88754)

Discover related pathways, diseases and genes to OVOL2 Antibody (NBP1-88754). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OVOL2 Antibody (NBP1-88754)

Discover more about diseases related to OVOL2 Antibody (NBP1-88754).
 

Pathways for OVOL2 Antibody (NBP1-88754)

View related products by pathway.

Blogs on OVOL2

There are no specific blogs for OVOL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OVOL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OVOL2
Entrez
Uniprot