OVCA1 Antibody (2C5) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related OVCA1 Primary Antibodies

Order Details


    • Catalog Number
      H00001801-M02PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

OVCA1 Antibody (2C5) [PerCP] Summary

Immunogen
DPH1 (NP_001374 216 a.a. - 324 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ILGCTSPRLSKEVEAVVYLGDGRFHLESVMIANPNVPAYRYDPYSKVLSREHYDHQRMQAARQEAIATARSAKSWGLILGTLGRQGSPKILEHLESRLRALGLSFVRLL
Specificity
DPH1 (2C5)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DPH1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for OVCA1 Antibody (2C5) [PerCP]

  • Diphthamide biosynthesis protein 2 homolog-like 1
  • Diphthamide biosynthesis protein 2-like
  • diptheria toxin resistance protein required for diphthamide biosynthesis(Saccharomyces)-like 1
  • diptheria toxin resistance protein required for diphthamide biosynthesis-like 1
  • diptheria toxin resistance protein required for diphthamide biosynthesis-like 1(S. cerevisiae)
  • DPH1 homolog (S. cerevisiae)
  • DPH1 homolog
  • DPH2L
  • DPH2L1diphthamide biosynthesis protein 1
  • DPH2-like 1
  • DPH-like 1 (S. cerevisiae)
  • DPH-like 1
  • FLJ33211
  • hsDph1
  • Ovarian cancer-associated gene 1 protein
  • ovarian tumor suppressor candidate 1
  • OVCA1candidate tumor suppressor in ovarian cancer 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03732
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-37620
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-56767
Species: Hu
Applications: WB, ICC/IF
NBP1-84276
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
H00003090-M02
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP2-13934
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88376
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-56536
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87969
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-17262
Species: Hu
Applications: WB, ICC/IF
NBP2-33286
Species: Hu
Applications: IHC, IHC-P
H00029978-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-90105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5540
Species: Mu
Applications: WB
NBP1-86892
Species: Hu
Applications: WB, IHC, IHC-P
H00007402-M01
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for OVCA1 Antibody (H00001801-M02PCP) (0)

There are no publications for OVCA1 Antibody (H00001801-M02PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OVCA1 Antibody (H00001801-M02PCP) (0)

There are no reviews for OVCA1 Antibody (H00001801-M02PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for OVCA1 Antibody (H00001801-M02PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional OVCA1 Products

Bioinformatics Tool for OVCA1 Antibody (H00001801-M02PCP)

Discover related pathways, diseases and genes to OVCA1 Antibody (H00001801-M02PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OVCA1 Antibody (H00001801-M02PCP)

Discover more about diseases related to OVCA1 Antibody (H00001801-M02PCP).
 

Pathways for OVCA1 Antibody (H00001801-M02PCP)

View related products by pathway.

PTMs for OVCA1 Antibody (H00001801-M02PCP)

Learn more about PTMs related to OVCA1 Antibody (H00001801-M02PCP).

Blogs on OVCA1

There are no specific blogs for OVCA1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OVCA1 Antibody (2C5) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol DPH1