Recombinant Human OTUD7B/Cezanne/ZA20D1 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related OTUD7B/Cezanne/ZA20D1 Peptides and Proteins

Order Details


    • Catalog Number
      H00056957-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human OTUD7B/Cezanne/ZA20D1 Protein Summary

Description
OTUD7B/Cezanne/ZA20D1 (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: DSIPSLEPGSHSKDGLHRGALLPPPYRVADSYSNGYREPPEPDGWAGGLRGLPPTQTKCKQPNCSFYGHPETNNFCSCCYREELRRREREPDGELLVHRF
Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
OTUD7B

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human OTUD7B/Cezanne/ZA20D1 Protein

  • cellular zinc finger NF-kappaB Cezanne
  • Cellular zinc finger NF-kappa-B protein
  • Cezanne
  • CEZANNEA20 domain containing 1
  • EC 3.4.19.12
  • OTU domain containing 7B
  • OTU domain-containing protein 7B
  • OTUD7B
  • ZA20D1
  • Zinc finger A20 domain-containing protein 1
  • Zinc finger protein Cezanne

Background

ZA20D1 - zinc finger, A20 domain containing 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77533
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-P, IP, CyTOF-ready
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-77077
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-270
Species: Hu, Mu, Rt, Ch
Applications: WB, Simple Western, ICC/IF, IP, In vitro
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32367
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-02293
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-34106
Species: Hu
Applications: IHC, IHC-P
NBP1-89926
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
796-IC
Species: Mu
NLS272
Species: Hu, Mu, Rt, Ha, Mk, Rb
Applications: IHC-P
NBP1-01469
Species: Hu
Applications: WB, PEP-ELISA
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for OTUD7B/Cezanne/ZA20D1 Partial Recombinant Protein (H00056957-Q01) (0)

There are no publications for OTUD7B/Cezanne/ZA20D1 Partial Recombinant Protein (H00056957-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OTUD7B/Cezanne/ZA20D1 Partial Recombinant Protein (H00056957-Q01) (0)

There are no reviews for OTUD7B/Cezanne/ZA20D1 Partial Recombinant Protein (H00056957-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OTUD7B/Cezanne/ZA20D1 Partial Recombinant Protein (H00056957-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional OTUD7B/Cezanne/ZA20D1 Products

Bioinformatics Tool for OTUD7B/Cezanne/ZA20D1 Partial Recombinant Protein (H00056957-Q01)

Discover related pathways, diseases and genes to OTUD7B/Cezanne/ZA20D1 Partial Recombinant Protein (H00056957-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OTUD7B/Cezanne/ZA20D1 Partial Recombinant Protein (H00056957-Q01)

Discover more about diseases related to OTUD7B/Cezanne/ZA20D1 Partial Recombinant Protein (H00056957-Q01).
 

Pathways for OTUD7B/Cezanne/ZA20D1 Partial Recombinant Protein (H00056957-Q01)

View related products by pathway.

PTMs for OTUD7B/Cezanne/ZA20D1 Partial Recombinant Protein (H00056957-Q01)

Learn more about PTMs related to OTUD7B/Cezanne/ZA20D1 Partial Recombinant Protein (H00056957-Q01).

Blogs on OTUD7B/Cezanne/ZA20D1

There are no specific blogs for OTUD7B/Cezanne/ZA20D1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human OTUD7B/Cezanne/ZA20D1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol OTUD7B
Entrez