OTUD3 Antibody


Western Blot: OTUD3 Antibody [NBP1-90485] - Analysis in human cell line RH-30.
Immunocytochemistry/ Immunofluorescence: OTUD3 Antibody [NBP1-90485] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol & intermediate filaments.
Immunohistochemistry-Paraffin: OTUD3 Antibody [NBP1-90485] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.
Immunohistochemistry-Paraffin: OTUD3 Antibody [NBP1-90485] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: OTUD3 Antibody [NBP1-90485] - Staining of human pancreas shows moderate cytoplasmic positivity in islets of Langerhans.
Immunohistochemistry-Paraffin: OTUD3 Antibody [NBP1-90485] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: OTUD3 Antibody [NBP1-90485] - Staining in human testis and liver tissues. Corresponding OTUD3 RNA-seq data are presented for the same tissues.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

OTUD3 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: KGMDSEDDLRDEVEDAVQKVCNATGCSDFNLIVQNLEAENYNIESAIIAVLRMNQGKRNNAEENLEPSGRVLKQCGP
Specificity of human, mouse OTUD3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Positive Control
OTUD3 Lysate (NBP2-64721)
Control Peptide
OTUD3 Protein (NBP1-90485PEP)
Read Publication using
NBP1-90485 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 26280536).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for OTUD3 Antibody

  • DUBA4
  • KIAA0459
  • OTU domain containing 3
  • OTUD3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for OTUD3 Antibody (NBP1-90485)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for OTUD3 Antibody (NBP1-90485) (0)

There are no reviews for OTUD3 Antibody (NBP1-90485). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for OTUD3 Antibody (NBP1-90485) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional OTUD3 Products

Bioinformatics Tool for OTUD3 Antibody (NBP1-90485)

Discover related pathways, diseases and genes to OTUD3 Antibody (NBP1-90485). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on OTUD3

There are no specific blogs for OTUD3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our OTUD3 Antibody and receive a gift card or discount.


Gene Symbol OTUD3