OTP Antibody

Images

 
Western Blot: OTP Antibody [NBP1-85861] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: OTP Antibody [NBP1-85861] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

OTP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VKCRLGVGGSDPGGHPGDLAPNSDPVEGATLLPGEDITTVGSTPASLAVSAKDPDKQPGPQGGPNPSQAGQQQGQQKQKRHRTRFTPAQLNELE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OTP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
OTP Protein (NBP1-85861PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for OTP Antibody

  • homeobox protein orthopedia
  • MGC3161
  • orthopedia homeobox
  • orthopedia homolog (Drosophila)
  • orthopedia homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-97773
Species: Hu
Applications: WB, PEP-ELISA
NB100-56467
Species: Hu, Ca, Pm
Applications: WB
NBP2-61436
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-P
NBP1-52131
Species: Hu
Applications: IHC, PEP-ELISA
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
MAB1980
Species: Hu
Applications: WB, Simple Western, IP, ICC
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF1979
Species: Hu
Applications: WB, Simple Western, ICC
H00006496-M04
Species: Hu
Applications: WB, ELISA
NBP1-35703
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-34014
Species: Hu
Applications: IHC, IHC-P
NBP1-88623
Species: Hu
Applications: IHC, IHC-P
AF1837
Species: Hu
Applications: WB, Simple Western, ICC
MAB1675
Species: Hu, Mu, Rt, Ch
Applications: ICC
NBP1-88619
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14934
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85861
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for OTP Antibody (NBP1-85861) (0)

There are no publications for OTP Antibody (NBP1-85861).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OTP Antibody (NBP1-85861) (0)

There are no reviews for OTP Antibody (NBP1-85861). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OTP Antibody (NBP1-85861) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional OTP Products

Bioinformatics Tool for OTP Antibody (NBP1-85861)

Discover related pathways, diseases and genes to OTP Antibody (NBP1-85861). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OTP Antibody (NBP1-85861)

Discover more about diseases related to OTP Antibody (NBP1-85861).
 

Pathways for OTP Antibody (NBP1-85861)

View related products by pathway.

PTMs for OTP Antibody (NBP1-85861)

Learn more about PTMs related to OTP Antibody (NBP1-85861).

Blogs on OTP

There are no specific blogs for OTP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OTP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OTP