Otoferlin Antibody

Images

 
Immunohistochemistry: Otoferlin Antibody [NBP1-85234] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Otoferlin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:WWSKYFASIDTMKEQLRQQEPSGIDLEEKEEVDNTEGLKGSMKGKEKARAAKEEKKKKTQSSGSGQGSEAPEKKKPKIDELKVYPKELESEFDNFEDWLHTFNLLRGKTGDDE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OTOF
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For Immunohistochemistry-Paraffin, HIER pH6 retrieval is recommended.
Control Peptide
Otoferlin Protein (NBP1-85234PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Otoferlin Antibody

  • AUNB1
  • DFNB6
  • DFNB9
  • EC 2.7.10.1
  • EC 4.2.1.11
  • FER1L2NSRD9
  • Fer-1-like protein 2
  • otoferlin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-15109
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-60106
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84266
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-84260
Species: Hu
Applications: IHC, IHC-P
NB110-75015
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84694
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
38160002
Species: Hu
Applications: WB, ELISA
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
NBP1-30981
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-46390
Species: Hu
Applications: WB, IHC
H00064699-M01
Species: Hu
Applications: WB, ELISA
AF5249
Species: Hu
Applications: WB
NBP1-85704
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12893
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
H00051168-Q01
Species: Hu
NBP1-56991
Species: Hu
Applications: WB
AF1936
Species: Hu
Applications: WB, IP

Publications for Otoferlin Antibody (NBP1-85234) (0)

There are no publications for Otoferlin Antibody (NBP1-85234).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Otoferlin Antibody (NBP1-85234) (0)

There are no reviews for Otoferlin Antibody (NBP1-85234). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Otoferlin Antibody (NBP1-85234) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Otoferlin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OTOF
Entrez
Uniprot