Recombinant Human Osteopontin/OPN Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Osteopontin/OPN Peptides and Proteins

Order Details


    • Catalog Number
      H00006696-Q02
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Osteopontin/OPN Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 21-129 of Human SPP1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:QADSGSSEEKQLYNKYPDAVATWLNPDPSQKQNLLAPQTLPSKSNESHDHMDDMDDEDDDDHVDSQDSIDSNDSDDVDDTDDSHQSDESHHSDESDELVTDFPTDLPAT

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
SPP1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Hepes, 100 mM NaCl, pH 7.5, 5 mM DTT, 15 mM reduced glutathione, 20% glycerol

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Osteopontin/OPN Protein

  • BNSP
  • Bone sialoprotein 1
  • Eta-1
  • MGC110940
  • Nephropontin
  • OPN
  • Osteopontin
  • secreted phosphoprotein 1bone sialoprotein I, early T-lymphocyteactivation 1)
  • secreted phosphoprotein-1 (osteopontin, bone sialoprotein)
  • Spp1
  • SPP-1
  • SPP1/CALPHA1 fusion
  • Urinary stone protein
  • uropontin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
AF942
Species: Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP2-32263
Species: Hu
Applications: WB, IHC, IP
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-42378
Species: Hu
Applications: WB, IHC
NBP1-89134
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
355-BM/CF
Species: Hu, Mu, Rt
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-91612
Species: Mu
Applications: WB
H00006696-Q02
Species: Hu
Applications: WB, ELISA, PA

Publications for Osteopontin/OPN Partial Recombinant Protein (H00006696-Q02) (0)

There are no publications for Osteopontin/OPN Partial Recombinant Protein (H00006696-Q02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Osteopontin/OPN Partial Recombinant Protein (H00006696-Q02) (0)

There are no reviews for Osteopontin/OPN Partial Recombinant Protein (H00006696-Q02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Osteopontin/OPN Partial Recombinant Protein (H00006696-Q02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Osteopontin/OPN Products

Bioinformatics Tool for Osteopontin/OPN Partial Recombinant Protein (H00006696-Q02)

Discover related pathways, diseases and genes to Osteopontin/OPN Partial Recombinant Protein (H00006696-Q02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Osteopontin/OPN Partial Recombinant Protein (H00006696-Q02)

Discover more about diseases related to Osteopontin/OPN Partial Recombinant Protein (H00006696-Q02).
 

Pathways for Osteopontin/OPN Partial Recombinant Protein (H00006696-Q02)

View related products by pathway.

PTMs for Osteopontin/OPN Partial Recombinant Protein (H00006696-Q02)

Learn more about PTMs related to Osteopontin/OPN Partial Recombinant Protein (H00006696-Q02).
 

Research Areas for Osteopontin/OPN Partial Recombinant Protein (H00006696-Q02)

Find related products by research area.

Blogs on Osteopontin/OPN

There are no specific blogs for Osteopontin/OPN, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Osteopontin/OPN Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SPP1
Entrez