Osteopontin/OPN Antibody (4D8)

Images

 
Western Blot: Osteopontin/OPN Antibody (4D8) [H00006696-M18] - Analysis of SPP1 expression in transfected 293T cell line by SPP1 monoclonal antibody (M18), clone 4D8. Lane 1: SPP1 transfected lysatE (35.4 KDa). Lane 2: ...read more

Product Details

Summary
Product Discontinued
View other related Osteopontin/OPN Primary Antibodies

Order Details


    • Catalog Number
      H00006696-M18
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Osteopontin/OPN Antibody (4D8) Summary

Immunogen
SPP1 (NP_000573.1, 21 a.a. - 129 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QADSGSSEEKQLYNKYPDAVATWLNPDPSQKQNLLAPQTLPSKSNESHDHMDDMDDEDDDDHVDSQDSIDSNDSDDVDDTDDSHQSDESHHSDESDELVTDFPTDLPAT
Specificity
Reacts with secreted phosphoprotein 1 (osteopontin, bone sialoprotein I, early T-lymphocyte activation 1).
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SPP1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
This antibody is reactive against recombinant protein in WB and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Osteopontin/OPN Antibody (4D8)

  • BNSP
  • Bone sialoprotein 1
  • Eta-1
  • MGC110940
  • Nephropontin
  • OPN
  • Osteopontin
  • secreted phosphoprotein 1bone sialoprotein I, early T-lymphocyteactivation 1)
  • secreted phosphoprotein-1 (osteopontin, bone sialoprotein)
  • Spp1
  • SPP-1
  • SPP1/CALPHA1 fusion
  • Urinary stone protein
  • uropontin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
AF942
Species: Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP2-32263
Species: Hu
Applications: WB, IHC, IP
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-42378
Species: Hu
Applications: WB, IHC
NBP1-89134
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
355-BM/CF
Species: Hu, Mu, Rt
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
46780002
Species: Hu
Applications: ELISA
H00006696-M18
Species: Hu
Applications: WB, ELISA

Publications for Osteopontin/OPN Antibody (H00006696-M18) (0)

There are no publications for Osteopontin/OPN Antibody (H00006696-M18).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Osteopontin/OPN Antibody (H00006696-M18) (0)

There are no reviews for Osteopontin/OPN Antibody (H00006696-M18). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Osteopontin/OPN Antibody (H00006696-M18) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Osteopontin/OPN Products

Bioinformatics Tool for Osteopontin/OPN Antibody (H00006696-M18)

Discover related pathways, diseases and genes to Osteopontin/OPN Antibody (H00006696-M18). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Osteopontin/OPN Antibody (H00006696-M18)

Discover more about diseases related to Osteopontin/OPN Antibody (H00006696-M18).
 

Pathways for Osteopontin/OPN Antibody (H00006696-M18)

View related products by pathway.

PTMs for Osteopontin/OPN Antibody (H00006696-M18)

Learn more about PTMs related to Osteopontin/OPN Antibody (H00006696-M18).

Blogs on Osteopontin/OPN

There are no specific blogs for Osteopontin/OPN, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Osteopontin/OPN Antibody (4D8) and receive a gift card or discount.

Bioinformatics

Gene Symbol SPP1
Entrez
Uniprot