Osteocalcin Antibody (2D4) [DyLight 755]



Product Details

Product Discontinued
View other related Osteocalcin Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Osteocalcin Antibody (2D4) [DyLight 755] Summary

BGLAP (NP_954642, 52 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
BGLAP - bone gamma-carboxyglutamate (gla) protein (osteocalcin)
IgG1 Lambda
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. It is also useful for immunofluorescence.

Packaging, Storage & Formulations

Store at 4C in the dark.
50mM Sodium Borate
0.05% Sodium Azide
IgG purified


Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Osteocalcin Antibody (2D4) [DyLight 755]

  • BGP
  • bone gamma-carboxyglutamate (gla) protein (osteocalcin)
  • bone gamma-carboxyglutamate (gla) protein
  • Bone Gla protein
  • Gamma-carboxyglutamic acid-containing protein
  • OC
  • OCN
  • Osteocalcin


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, MiAr
Species: Hu, Ca, Rt(-)
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
Species: Hu
Applications: WB, IHC, IP
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Osteocalcin Antibody (H00000632-M01IR) (0)

There are no publications for Osteocalcin Antibody (H00000632-M01IR).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Osteocalcin Antibody (H00000632-M01IR) (0)

There are no reviews for Osteocalcin Antibody (H00000632-M01IR). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Osteocalcin Antibody (H00000632-M01IR) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Osteocalcin Products

Related Products by Gene

Bioinformatics Tool for Osteocalcin Antibody (H00000632-M01IR)

Discover related pathways, diseases and genes to Osteocalcin Antibody (H00000632-M01IR). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Osteocalcin Antibody (H00000632-M01IR)

Discover more about diseases related to Osteocalcin Antibody (H00000632-M01IR).

Pathways for Osteocalcin Antibody (H00000632-M01IR)

View related products by pathway.

PTMs for Osteocalcin Antibody (H00000632-M01IR)

Learn more about PTMs related to Osteocalcin Antibody (H00000632-M01IR).

Research Areas for Osteocalcin Antibody (H00000632-M01IR)

Find related products by research area.

Blogs on Osteocalcin

There are no specific blogs for Osteocalcin, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Osteocalcin Antibody (2D4) [DyLight 755] and receive a gift card or discount.


Gene Symbol BGLAP