Osteoactivin/GPNMB Antibody

Images

 
Western Blot: Osteoactivin/GPNMB Antibody [NBP1-69306] - This Anti-GPNMB antibody was used in Western Blot of 293T tissue lysate at a concentration of 1ug/ml.
Immunohistochemistry: Osteoactivin/GPNMB Antibody [NBP1-69306] - HepG2

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Osteoactivin/GPNMB Antibody Summary

Immunogen
Synthetic peptides corresponding to GPNMB(glycoprotein (transmembrane) nmb) The peptide sequence was selected from the N terminal of GPNMB. Peptide sequence KGGRVQAVLTSDSPALVGSNITFAVNLIFPRCQKEDANGNIVYEKNCRNE.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GPNMB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against GPNMB and was validated on Western blot.
Theoretical MW
60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Osteoactivin/GPNMB Antibody

  • DC-HIL
  • glycoprotein (transmembrane) nmb
  • glycoprotein NMB
  • GPNMB
  • HGFIN
  • HGFINglycoprotein nmb-like protein
  • NMBosteoactivin
  • Osteoactivin
  • Transmembrane glycoprotein HGFIN
  • transmembrane glycoprotein NMB

Background

GPNMB is a type I transmembrane glycoprotein which shows homology to the pMEL17 precursor, a melanocyte-specific protein. GPNMB shows expression in the lowly metastatic human melanoma cell lines and xenografts but does not show expression in the highly metastatic cell lines. GPNMB may be involved in growth delay and reduction of metastatic potential. The protein encoded by this gene is a type I transmembrane glycoprotein which shows homology to the pMEL17 precursor, a melanocyte-specific protein. GPNMB shows expression in the lowly metastatic human melanoma cell lines and xenografts but does not show expression in the highly metastatic cell lines. GPNMB may be involved in growth delay and reduction of metastatic potential. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NLS830
Species: Hu, Po, Bt, Ca, Eq, Mk, Pm, Rb
Applications: WB, IHC, IHC-P
NBP1-86846
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33469
Species: Hu
Applications: IHC, IHC-P
NBP1-91923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-201
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NLS825
Species: Hu, Mu, Po, Bt, Bv, Eq, Rb
Applications: IHC-P
NBP1-46576
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NBP1-69306
Species: Hu
Applications: WB, IHC

Publications for Osteoactivin/GPNMB Antibody (NBP1-69306) (0)

There are no publications for Osteoactivin/GPNMB Antibody (NBP1-69306).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Osteoactivin/GPNMB Antibody (NBP1-69306) (0)

There are no reviews for Osteoactivin/GPNMB Antibody (NBP1-69306). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Osteoactivin/GPNMB Antibody (NBP1-69306) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Osteoactivin/GPNMB Products

Bioinformatics Tool for Osteoactivin/GPNMB Antibody (NBP1-69306)

Discover related pathways, diseases and genes to Osteoactivin/GPNMB Antibody (NBP1-69306). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Osteoactivin/GPNMB Antibody (NBP1-69306)

Discover more about diseases related to Osteoactivin/GPNMB Antibody (NBP1-69306).
 

Pathways for Osteoactivin/GPNMB Antibody (NBP1-69306)

View related products by pathway.

PTMs for Osteoactivin/GPNMB Antibody (NBP1-69306)

Learn more about PTMs related to Osteoactivin/GPNMB Antibody (NBP1-69306).
 

Research Areas for Osteoactivin/GPNMB Antibody (NBP1-69306)

Find related products by research area.

Blogs on Osteoactivin/GPNMB

There are no specific blogs for Osteoactivin/GPNMB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Osteoactivin/GPNMB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GPNMB
Entrez
Uniprot