Recombinant Human OSMR Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human OSMR Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 141-240 of Human OSMR

Source: Wheat Germ

Amino Acid Sequence: QDSTGQDILFVFPKDKLVEEGTNVTICYVSRNIQNNVSCYLEGKQIHGEQLDPHVTAFNLNSVPFIRNKGTNIYCEASQGNVSEGMKGIVLFVSKVLEEP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
OSMR
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human OSMR Protein

  • IL-31 receptor subunit beta
  • IL-31R subunit beta
  • IL-31RB
  • IL-31R-beta
  • Interleukin-31 receptor subunit beta
  • MGC150627
  • MGC75127
  • oncostatin M receptor
  • oncostatin-M specific receptor beta subunit
  • oncostatin-M-specific receptor subunit beta
  • OSMRBMGC150626

Background

Oncostatin M is a member of the IL6 family of cytokines. Functional receptors for IL6 family cytokines are multisubunit complexes involving members of the hematopoietin receptor superfamily. Many IL6 cytokines utilize gp130 as a common receptor subunit. OSM binds to the gp130 receptor subunit and, in association with the leukemia inhibitory factor receptor, induces a proliferative response in permissive cells. OSMR is an alternative subunit (for an OSM receptor complex (a heterodimer of gp130 and OSMR) that is activated by OSM but not by LIF [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86729
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF-228-NA
Species: Hu
Applications: WB, Neut
AF-249-NA
Species: Hu
Applications: WB, Neut
NBP1-32744
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF2769
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD
MAB4260
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
NBP2-67429
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
H00009180-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for OSMR Partial Recombinant Protein (H00009180-Q01) (0)

There are no publications for OSMR Partial Recombinant Protein (H00009180-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OSMR Partial Recombinant Protein (H00009180-Q01) (0)

There are no reviews for OSMR Partial Recombinant Protein (H00009180-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OSMR Partial Recombinant Protein (H00009180-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional OSMR Products

Bioinformatics Tool for OSMR Partial Recombinant Protein (H00009180-Q01)

Discover related pathways, diseases and genes to OSMR Partial Recombinant Protein (H00009180-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OSMR Partial Recombinant Protein (H00009180-Q01)

Discover more about diseases related to OSMR Partial Recombinant Protein (H00009180-Q01).
 

Pathways for OSMR Partial Recombinant Protein (H00009180-Q01)

View related products by pathway.

PTMs for OSMR Partial Recombinant Protein (H00009180-Q01)

Learn more about PTMs related to OSMR Partial Recombinant Protein (H00009180-Q01).

Blogs on OSMR

There are no specific blogs for OSMR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human OSMR Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol OSMR