Recombinant Human OSCAR Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human OSCAR Protein Summary

Description
OSCAR (Human) GST-Tagged Recombinant Protein (Q01)

Source: Wheat Germ (in vitro)

Amino Acid Sequence: TLLGARAPGTYSCYYHTPSAPYVLSQRSEVLVISWEGEGPEARPASSAPGMQAPGPPPSDPGAQAPSLSSFRPRGLVLQP
Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
OSCAR

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human OSCAR Protein

  • hOSCAR
  • MGC33613
  • OSCAR
  • osteoclast associated receptor OSCAR-S1
  • osteoclast associated receptor OSCAR-S2
  • osteoclast associated, immunoglobulin-like receptor
  • osteoclast-associated immunoglobulin-like receptor
  • Osteoclast-associated receptor
  • PIGR3
  • PIgR-3
  • Poly-Ig receptor 3
  • Polymeric immunoglobulin receptor 3

Background

Osteoclasts are multinucleated cells that resorb bone and are essential for bone homeostasis. This gene encodes an osteoclast-associated receptor (OSCAR), which is a member of the leukocyte receptor complex (LRC) protein family that plays critical roles in the regulation of both innate and adaptive immune responses. Different from the other LRC members, OSCAR expression is detected specifically in preosteoclasts or mature osteoclasts. OSCAR may be an important bone-specific regulator of osteoclast differentiation. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56508
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
NB100-56732
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
NBP2-45293
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IF
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87315
Species: Hu
Applications: IHC, IHC-P
H00057410-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP2-16456
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56561
Species: Hu, Mu, Rt
Applications: WB
H00001513-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP1-89827
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
H00171023-M05
Species: Hu
Applications: WB, ELISA
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NB100-55256
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-87769
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB20172
Species: Hu
Applications: WB, CyTOF-reported, Neut
H00126014-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for OSCAR Partial Recombinant Protein (H00126014-Q01) (0)

There are no publications for OSCAR Partial Recombinant Protein (H00126014-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OSCAR Partial Recombinant Protein (H00126014-Q01) (0)

There are no reviews for OSCAR Partial Recombinant Protein (H00126014-Q01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OSCAR Partial Recombinant Protein (H00126014-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Recombinant Human OSCAR Protein Products

Related Products by Gene

Bioinformatics Tool for OSCAR Partial Recombinant Protein (H00126014-Q01)

Discover related pathways, diseases and genes to OSCAR Partial Recombinant Protein (H00126014-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OSCAR Partial Recombinant Protein (H00126014-Q01)

Discover more about diseases related to OSCAR Partial Recombinant Protein (H00126014-Q01).
 

Pathways for OSCAR Partial Recombinant Protein (H00126014-Q01)

View related products by pathway.

PTMs for OSCAR Partial Recombinant Protein (H00126014-Q01)

Learn more about PTMs related to OSCAR Partial Recombinant Protein (H00126014-Q01).

Blogs on OSCAR

There are no specific blogs for OSCAR, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human OSCAR Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol OSCAR
Entrez

Customers Who Bought This Also Bought