OSBPL11 Antibody

Images

 
Western Blot: OSBPL11 Antibody [NBP1-69209] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related OSBPL11 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69209
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

OSBPL11 Antibody Summary

Immunogen
Synthetic peptides corresponding to OSBPL11 (oxysterol binding protein-like 11) The peptide sequence was selected from the C terminal of OSBPL11. Peptide sequence VDLTKLAVTKKRVRPLEKQDPFESRRLWKNVTDSLRESEIDKATEHKHTL.
Clonality
Polyclonal
Host
Rabbit
Gene
OSBPL11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against OSBPL11 and was validated on Western blot.
Theoretical MW
84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for OSBPL11 Antibody

  • FLJ13012
  • FLJ13164
  • ORP11OSBP-related protein 11
  • ORP-11TCCCIA00292
  • OSBP12
  • oxysterol binding protein-like 11
  • oxysterol-binding protein-related protein 11

Background

This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Like most members, the encoded protein contains an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00935
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-81054
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-19634
Species: Hu
Applications: WB, ICC/IF
NB500-526
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-85954
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-81388
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-31898
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82968
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92236
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49643
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP1-31456
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2448
Species: Hu
Applications: WB, PEP-ELISA
NBP2-24551
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF1443
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP1-81403
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-69209
Species: Hu
Applications: WB

Publications for OSBPL11 Antibody (NBP1-69209) (0)

There are no publications for OSBPL11 Antibody (NBP1-69209).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OSBPL11 Antibody (NBP1-69209) (0)

There are no reviews for OSBPL11 Antibody (NBP1-69209). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OSBPL11 Antibody (NBP1-69209) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional OSBPL11 Products

Bioinformatics Tool for OSBPL11 Antibody (NBP1-69209)

Discover related pathways, diseases and genes to OSBPL11 Antibody (NBP1-69209). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OSBPL11 Antibody (NBP1-69209)

Discover more about diseases related to OSBPL11 Antibody (NBP1-69209).

Research Areas for OSBPL11 Antibody (NBP1-69209)

Find related products by research area.

Blogs on OSBPL11

There are no specific blogs for OSBPL11, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OSBPL11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OSBPL11
Uniprot