ORC4L Antibody (2A8) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related ORC4L Primary Antibodies

Order Details


    • Catalog Number
      H00005000-M05PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ORC4L Antibody (2A8) [PerCP] Summary

Immunogen
ORC4L (AAH05388, 1 a.a. - 248 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSSRKSKSNSLIHTECLSQVQRILRERFCRQSPHSNLFGVQVQYKHLSELLKRTALHGESNSVLIIGPRGSGKTMLISHALKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLNLENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDISQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPAEFPDKVFAEK
Specificity
ORC4L (2A8)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ORC4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ORC4L Antibody (2A8) [PerCP]

  • HsORC4
  • ORC4LFLJ46668
  • ORC4P
  • origin recognition complex subunit 4
  • origin recognition complex, subunit 4 (yeast homolog)-like
  • origin recognition complex, subunit 4 homolog (S. cerevisiae)
  • origin recognition complex, subunit 4 homolog
  • origin recognition complex, subunit 4
  • origin recognition complex, subunit 4-like (S. cerevisiae)
  • origin recognition complex, subunit 4-like (yeast)
  • origin recognition complex, subunit 4-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24600
Species: Hu, Mu
Applications: WB
NBP2-20387
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-82476
Species: Hu
Applications: ICC/IF, IHC, IHC-P, ICC
NB200-581
Species: Hu, Rt
Applications: WB, IP
H00023594-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-06099
Species: Hu
NBP1-46175
Species: Hu
Applications: WB, IHC-P, IP, PLA
NB100-2567
Species: Hu
Applications: WB, IHC-P, IP
NBP1-46177
Species: Hu
Applications: IP (-), WB, IHC, IHC-P
MAB92171
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP2-43834
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-46403
Species: Hu
Applications: IHC
NBP1-87423
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-249
Species: Hu
Applications: WB, IHC, PLA, ICC
NBP1-87098
Species: Hu
Applications: IHC, IHC-P
NBP2-45224
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85723
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NB100-288
Species: Hu, Xp
Applications: WB, IHC, IHC-P, IP, PLA

Publications for ORC4L Antibody (H00005000-M05PCP) (0)

There are no publications for ORC4L Antibody (H00005000-M05PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ORC4L Antibody (H00005000-M05PCP) (0)

There are no reviews for ORC4L Antibody (H00005000-M05PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ORC4L Antibody (H00005000-M05PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ORC4L Products

Bioinformatics Tool for ORC4L Antibody (H00005000-M05PCP)

Discover related pathways, diseases and genes to ORC4L Antibody (H00005000-M05PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ORC4L Antibody (H00005000-M05PCP)

Discover more about diseases related to ORC4L Antibody (H00005000-M05PCP).
 

Pathways for ORC4L Antibody (H00005000-M05PCP)

View related products by pathway.

PTMs for ORC4L Antibody (H00005000-M05PCP)

Learn more about PTMs related to ORC4L Antibody (H00005000-M05PCP).

Blogs on ORC4L

There are no specific blogs for ORC4L, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ORC4L Antibody (2A8) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol ORC4