ORC1 Antibody (3H1)

Images

 
Immunohistochemistry-Paraffin: ORC1 Antibody (3H1) [H00004998-M01] - Analysis of monoclonal antibody to ORC1L on formalin-fixed paraffin-embedded human uterine cervix. Antibody concentration 3 ug/ml.
Sandwich ELISA: ORC1 Antibody (3H1) [H00004998-M01] - Detection limit for recombinant GST tagged ORC1L is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, IHC-P
Clone
3H1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ORC1 Antibody (3H1) Summary

Immunogen
ORC1L (AAH11539, 1 a.a. - 110 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAHYPTRLKTRKTYSWVGRPLLDRKLHYQTYREMCVKTEGCSTEIHIQIGQFVLIEGDDDENPYVAKLLELFEDDSDPPPKKRARVQWFVRFCEVPACKRHLLGRKPGAQ
Specificity
ORC1L - origin recognition complex, subunit 1-like (yeast) (3H1)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ORC1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ORC1 Antibody (3H1)

  • HS
  • HSORC1
  • ORC1Lorigin recognition complex subunit 1
  • origin recognition complex, subunit 1 (yeast homolog)-like
  • origin recognition complex, subunit 1 homolog (S. cerevisiae)
  • origin recognition complex, subunit 1 homolog
  • origin recognition complex, subunit 1
  • origin recognition complex, subunit 1-like (yeast)
  • origin recognition complex, subunit 1-like
  • PARC1origin recognition complex 1
  • Replication control protein 1

Background

The origin recognition complex (ORC) is a highly conserved six subunits protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. The protein encoded by this gene is the largest subunit of the ORC complex. While other ORC subunits are stable throughout the cell cycle, the levels of this protein vary during the cell cycle, which has been shown to be controlled by ubiquitin-mediated proteolysis after initiation of DNA replication. This protein is found to be selectively phosphorylated during mitosis. It is also reported to interact with MYST histone acetyltransferase 2 (MyST2/HBO1), a protein involved in control of transcription silencing. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-581
Species: Hu, Rt
Applications: WB, IP
H00083884-R01
Species: Hu
NBP1-46175
Species: Hu
Applications: WB, IHC-P, IP, PLA
NBP2-46403
Species: Hu
Applications: IHC
NBP1-87423
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-56938
Species: Hu
Applications: WB, ICC/IF
H00023594-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-82476
Species: Hu
Applications: ICC/IF, IHC, IHC-P, ICC
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-2567
Species: Hu
Applications: WB, IHC-P, IP
NBP1-46177
Species: Hu
Applications: IP (-), WB, IHC, IHC-P
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
NB100-290
Species: Hu, Mu, Xp
Applications: IP (-), WB, IHC, PLA
MAB92171
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NB100-249
Species: Hu
Applications: WB, IHC, PLA, ICC
NB100-56506
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, CyTOF-ready
NB100-79778
Species: Hu, Xp
Applications: WB, IHC, PLA
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready

Publications for ORC1 Antibody (H00004998-M01) (0)

There are no publications for ORC1 Antibody (H00004998-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ORC1 Antibody (H00004998-M01) (0)

There are no reviews for ORC1 Antibody (H00004998-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ORC1 Antibody (H00004998-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ORC1 Products

Bioinformatics Tool for ORC1 Antibody (H00004998-M01)

Discover related pathways, diseases and genes to ORC1 Antibody (H00004998-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ORC1 Antibody (H00004998-M01)

Discover more about diseases related to ORC1 Antibody (H00004998-M01).
 

Pathways for ORC1 Antibody (H00004998-M01)

View related products by pathway.

PTMs for ORC1 Antibody (H00004998-M01)

Learn more about PTMs related to ORC1 Antibody (H00004998-M01).
 

Research Areas for ORC1 Antibody (H00004998-M01)

Find related products by research area.

Blogs on ORC1

There are no specific blogs for ORC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ORC1 Antibody (3H1) and receive a gift card or discount.

Bioinformatics

Gene Symbol ORC1
Entrez
Uniprot