Recombinant Human OR8D1 Protein

Images

 
There are currently no images for OR8D1 Recombinant Protein (H00283159-G01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary

Order Details

Recombinant Human OR8D1 Protein Summary

Description
OR8D1 (Human) Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MTMENYSMAAQFVLDGLTQQAELQLPLFLLFLGIYVVTVVGNLGMILLIAVSPLLHTPMYYFLSSLSFVDFCYSSVITPKMLVNFLGKKNTILYSECMVQLFFFVVFVVAEGYLLTAMAYDRYVAICSPLLYNAIMSSWVCSLLVLAAFFLGFLSALTHTSAMMKLSFCKSHIINHYFCDVLPLLNLSCSNTHLNELLLFIIAGFNTLVPTLAVAVSYAFILYSILHIRSSEGRSKAFGTCSSHLMAVVIFFGSITFMYFKPPSSNSLDQEKVSSVFYTTVIPMLNPLIYSLRNKDVKKALRKVLVGK
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
OR8D1

Applications/Dilutions

Application Notes
This product is recommended to use in Functional study and Compund screening, not validated yet.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Preservative
No Preservative

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human OR8D1 Protein

  • JCG9
  • olfactory receptor 8D1
  • Olfactory receptor 8D3
  • Olfactory receptor OR11-301
  • olfactory receptor, family 8, subfamily D, member 1
  • olfactory receptor, family 8, subfamily D, member 3
  • Olfactory receptor-like protein JCG9
  • olfactory-like receptor JCG9
  • OR8D3
  • OST004PDJ9J14

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00120065-P01
Species: Hu
H00026493-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
H00283297-R02
Species: Hu
NBP2-31568
Species: Hu
Applications: IHC, IHC-P
H00144124-R02
Species: Hu
H00283160-R02
Species: Hu
H00219952-R02
Species: Hu
NLS4354
Species: Hu
Applications: IHC-P
NBP2-32566
Species: Hu
Applications: IHC, IHC-P
NBP2-13714
Species: Hu
Applications: WB, IHC, IHC-P

Publications for OR8D1 Recombinant Protein (H00283159-G01) (0)

There are no publications for OR8D1 Recombinant Protein (H00283159-G01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OR8D1 Recombinant Protein (H00283159-G01) (0)

There are no reviews for OR8D1 Recombinant Protein (H00283159-G01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

FAQs for OR8D1 Recombinant Protein (H00283159-G01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Recombinant Human OR8D1 Protein Products

Related Products by Gene

Bioinformatics Tool for OR8D1 Recombinant Protein (H00283159-G01)

Discover related pathways, diseases and genes to OR8D1 Recombinant Protein (H00283159-G01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on OR8D1

There are no specific blogs for OR8D1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human OR8D1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol OR8D1

Customers Who Bought This Also Bought

OR7A5 Antibody
NBP2-31568
OR7A5 Antibody
NBP2-31568
OR7A5 Antibody
NBP2-31568
OR8D1 Antibody
NBP2-32472
OR8D1 Antibody
NBP2-32472
OR8D1 Antibody
NBP2-32472
OR7C1 Antibody
NBP2-13714
OR7C1 Antibody
NBP2-13714