OR8D1 Recombinant Protein

Images

 
There are currently no images for OR8D1 Recombinant Protein (H00283159-G01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary

Order Details

OR8D1 Recombinant Protein Summary

Description
OR8D1 (Human) Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MTMENYSMAAQFVLDGLTQQAELQLPLFLLFLGIYVVTVVGNLGMILLIAVSPLLHTPMYYFLSSLSFVDFCYSSVITPKMLVNFLGKKNTILYSECMVQLFFFVVFVVAEGYLLTAMAYDRYVAICSPLLYNAIMSSWVCSLLVLAAFFLGFLSALTHTSAMMKLSFCKSHIINHYFCDVLPLLNLSCSNTHLNELLLFIIAGFNTLVPTLAVAVSYAFILYSILHIRSSEGRSKAFGTCSSHLMAVVIFFGSITFMYFKPPSSNSLDQEKVSSVFYTTVIPMLNPLIYSLRNKDVKKALRKVLVGK
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Gene
OR8D1

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Preservative
No Preservative

Applications/Dilutions

Application Notes
This product is recommended to use in Functional study and Compund screening, not validated yet.

Reactivity Notes

Human

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for OR8D1 Recombinant Protein

  • JCG9
  • olfactory receptor 8D1
  • Olfactory receptor 8D3
  • Olfactory receptor OR11-301
  • olfactory receptor, family 8, subfamily D, member 1
  • olfactory receptor, family 8, subfamily D, member 3
  • Olfactory receptor-like protein JCG9
  • olfactory-like receptor JCG9
  • OR8D3
  • OST004PDJ9J14

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00120065-P01
Species: Hu
H00026493-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
H00283297-R02
Species: Hu
NBP2-31568
Species: Hu
Applications: IHC, IHC-P
H00144124-R02
Species: Hu
H00283160-P01
Species: Hu
H00219952-R02
Species: Hu
NLS4355
Species: Hu
Applications: IHC-P
NBP2-32566
Species: Hu
Applications: IHC, IHC-P
NBP2-13714
Species: Hu
Applications: WB, IHC, IHC-P

Publications for OR8D1 Recombinant Protein (H00283159-G01) (0)

There are no publications for OR8D1 Recombinant Protein (H00283159-G01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OR8D1 Recombinant Protein (H00283159-G01) (0)

There are no reviews for OR8D1 Recombinant Protein (H00283159-G01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

FAQs for OR8D1 Recombinant Protein (H00283159-G01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional OR8D1 Recombinant Protein Products

Related Products by Gene

Bioinformatics Tool for OR8D1 Recombinant Protein (H00283159-G01)

Discover related pathways, diseases and genes to OR8D1 Recombinant Protein (H00283159-G01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on OR8D1

There are no specific blogs for OR8D1, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol OR8D1

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on H00283159-G01 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought

OR8D1 Recombinant Protein
H00283159-P01-2ug
OR7A5 Antibody
NBP2-31568
OR7A5 Antibody
NBP2-31568
OR7A5 Antibody
NBP2-31568
OR8D1 Antibody
NBP2-32472
OR8D1 Antibody
NBP2-32472
OR8D1 Antibody
NBP2-32472
OR7C1 Antibody
NBP2-13714
OR7C1 Antibody
NBP2-13714