Recombinant Human OR1A2 Protein

Images

 
There are currently no images for OR1A2 Recombinant Protein (H00026189-G01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications Func, AP

Order Details

Recombinant Human OR1A2 Protein Summary

Description
An untagged recombinant protein corresponding to the amino acid sequence of (NP_036484.1) for Human OR1A2

Source: Wheat Germ

Amino Acid Sequence: MKKENQSFNLDFILLGVTSQQEQNNVFFVIFLCIYPITLTGNLLIILAICADIRLHNPMYFLLANLSLVDIIFSSVTIPKVLANHLLGSKFISFGGCLMQMYFMIALAKADSYTLAAMAYDRAVAISCPLHYTTIMSPRSCILLIAGSWVIGNTSALPHTLLTASLSFCGNQEVANFYCDIMPLLKLSCSDVHFNVKMMYLGVGVFSLPLLCIIVSYVQVFSTVFQVPSTKSLFKAFCTCGSHLTVVFLYYGTTMGMYFRPLTSYSPKDAVITVMYVAVTPALNPFIYSLRNWDMKAALQKLFSKRISS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
OR1A2
Purity
N/A

Applications/Dilutions

Theoretical MW
34.4 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Preservative
No Preservative
Purity
N/A

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human OR1A2 Protein

  • MGC119930
  • Olfactory receptor 17-6
  • olfactory receptor 1A2
  • Olfactory receptor OR17-10
  • olfactory receptor, family 1, subfamily A, member 2
  • OR17-6MGC119931

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008383-P01
Species: Hu
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP

Publications for OR1A2 Recombinant Protein (H00026189-G01) (0)

There are no publications for OR1A2 Recombinant Protein (H00026189-G01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OR1A2 Recombinant Protein (H00026189-G01) (0)

There are no reviews for OR1A2 Recombinant Protein (H00026189-G01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for OR1A2 Recombinant Protein (H00026189-G01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional OR1A2 Products

OR1A2 H00026189-G01

Bioinformatics Tool for OR1A2 Recombinant Protein (H00026189-G01)

Discover related pathways, diseases and genes to OR1A2 Recombinant Protein (H00026189-G01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on OR1A2

There are no specific blogs for OR1A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human OR1A2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol OR1A2