Opsin 1 (Medium Wave) Antibody

Images

 
Western Blot: Opsin 1 (Medium Wave) Antibody [NBP1-69046] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related Opsin 1 (Medium Wave) Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69046
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Opsin 1 (Medium Wave) Antibody Summary

Immunogen
Synthetic peptides corresponding to OPN1MW (opsin 1 (cone pigments), medium-wave-sensitive) The peptide sequence was selected from the C terminal of OPN1MW. Peptide sequence SATIYNPVIYVFMNRQFRNCILQLFGKKVDDGSELSSASKTEVSSVSSVS.
Clonality
Polyclonal
Host
Rabbit
Gene
OPN1MW
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against OPN1MW and was validated on Western blot.
Theoretical MW
40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Opsin 1 (Medium Wave) Antibody

  • GCP
  • GOP
  • Green cone photoreceptor pigment
  • Green-sensitive opsin
  • medium-wave-sensitive opsin 1
  • OPN1MW
  • opsin 1 (cone pigments), medium-wave-sensitive 2

Background

This gene encodes for a light absorbing visual pigment of the opsin gene family. The encoded protein is called green cone photopigment or medium-wavelength sensitive opsin. Opsins are G-protein coupled receptors with seven transmembrane domains, an N-terminal extracellular domain, and a C-terminal cytoplasmic domain. The long-wavelength opsin gene and multiple copies of the medium-wavelength opsin gene are tandemly arrayed on the X chromosome and frequent unequal recombination and gene conversion may occur between these sequences. X chromosomes may have fusions of the medium- and long-wavelength opsin genes or may have more than one copy of these genes. Defects in this gene are the cause of deutanopic colorblindness.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-45057
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
H00005956-R02
Species: Hu
MAB333
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-52546
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP1-84495
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-236
Species: Hu, Mu
Applications: WB, IB, IHC, IHC-Fr, IHC-P, IP
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP2-00823
Species: Hu, Mu, Rt, Ca
Applications: WB, Flow, IHC, IHC-P
NBP1-84956
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-91761
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2436
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-230
Species: Hu
Applications: WB, IP, PLA
NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
PP-B0422-00
Species: Hu, Mu
Applications: WB, IHC, IP, DirELISA
NBP2-20116
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-69046
Species: Hu
Applications: WB

Publications for Opsin 1 (Medium Wave) Antibody (NBP1-69046) (0)

There are no publications for Opsin 1 (Medium Wave) Antibody (NBP1-69046).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Opsin 1 (Medium Wave) Antibody (NBP1-69046) (0)

There are no reviews for Opsin 1 (Medium Wave) Antibody (NBP1-69046). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Opsin 1 (Medium Wave) Antibody (NBP1-69046) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Opsin 1 (Medium Wave) Products

Bioinformatics Tool for Opsin 1 (Medium Wave) Antibody (NBP1-69046)

Discover related pathways, diseases and genes to Opsin 1 (Medium Wave) Antibody (NBP1-69046). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Opsin 1 (Medium Wave) Antibody (NBP1-69046)

Discover more about diseases related to Opsin 1 (Medium Wave) Antibody (NBP1-69046).
 

Pathways for Opsin 1 (Medium Wave) Antibody (NBP1-69046)

View related products by pathway.

PTMs for Opsin 1 (Medium Wave) Antibody (NBP1-69046)

Learn more about PTMs related to Opsin 1 (Medium Wave) Antibody (NBP1-69046).
 

Research Areas for Opsin 1 (Medium Wave) Antibody (NBP1-69046)

Find related products by research area.

Blogs on Opsin 1 (Medium Wave)

There are no specific blogs for Opsin 1 (Medium Wave), but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Opsin 1 (Medium Wave) Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OPN1MW
Uniprot