Opsin 1 (Medium Wave) Antibody


Western Blot: Opsin 1 (Medium Wave) Antibody [NBP1-69046] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Product Discontinued
View other related Opsin 1 (Medium Wave) Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Opsin 1 (Medium Wave) Antibody Summary

Synthetic peptides corresponding to OPN1MW (opsin 1 (cone pigments), medium-wave-sensitive) The peptide sequence was selected from the C terminal of OPN1MW. Peptide sequence SATIYNPVIYVFMNRQFRNCILQLFGKKVDDGSELSSASKTEVSSVSSVS.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against OPN1MW and was validated on Western blot.
Theoretical MW
40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Opsin 1 (Medium Wave) Antibody

  • GCP
  • GOP
  • Green cone photoreceptor pigment
  • Green-sensitive opsin
  • medium-wave-sensitive opsin 1
  • OPN1MW
  • opsin 1 (cone pigments), medium-wave-sensitive 2


This gene encodes for a light absorbing visual pigment of the opsin gene family. The encoded protein is called green cone photopigment or medium-wavelength sensitive opsin. Opsins are G-protein coupled receptors with seven transmembrane domains, an N-terminal extracellular domain, and a C-terminal cytoplasmic domain. The long-wavelength opsin gene and multiple copies of the medium-wavelength opsin gene are tandemly arrayed on the X chromosome and frequent unequal recombination and gene conversion may occur between these sequences. X chromosomes may have fusions of the medium- and long-wavelength opsin genes or may have more than one copy of these genes. Defects in this gene are the cause of deutanopic colorblindness.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
Species: Hu
Species: Hu
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IB, IHC-Fr, IP
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
Species: Hu, Mu, Rt, Ca
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, IP, PLA
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
Species: Hu, Mu
Applications: WB, IHC, IP, DirELISA
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Opsin 1 (Medium Wave) Antibody (NBP1-69046) (0)

There are no publications for Opsin 1 (Medium Wave) Antibody (NBP1-69046).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Opsin 1 (Medium Wave) Antibody (NBP1-69046) (0)

There are no reviews for Opsin 1 (Medium Wave) Antibody (NBP1-69046). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Opsin 1 (Medium Wave) Antibody (NBP1-69046) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Opsin 1 (Medium Wave) Products

Bioinformatics Tool for Opsin 1 (Medium Wave) Antibody (NBP1-69046)

Discover related pathways, diseases and genes to Opsin 1 (Medium Wave) Antibody (NBP1-69046). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Opsin 1 (Medium Wave) Antibody (NBP1-69046)

Discover more about diseases related to Opsin 1 (Medium Wave) Antibody (NBP1-69046).

Pathways for Opsin 1 (Medium Wave) Antibody (NBP1-69046)

View related products by pathway.

PTMs for Opsin 1 (Medium Wave) Antibody (NBP1-69046)

Learn more about PTMs related to Opsin 1 (Medium Wave) Antibody (NBP1-69046).

Research Areas for Opsin 1 (Medium Wave) Antibody (NBP1-69046)

Find related products by research area.

Blogs on Opsin 1 (Medium Wave)

There are no specific blogs for Opsin 1 (Medium Wave), but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Opsin 1 (Medium Wave) Antibody and receive a gift card or discount.


Gene Symbol OPN1MW