Oncostatin M/OSM Antibody

Images

 
Western Blot: Oncostatin M Antibody [NBP1-87768] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate ...read more
Immunohistochemistry-Paraffin: Oncostatin M Antibody [NBP1-87768] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Product Discontinued
View other related Oncostatin M/OSM Primary Antibodies

Order Details


    • Catalog Number
      NBP1-87768
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Oncostatin M/OSM Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OSM
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using NBP1-87768.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23318420)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Oncostatin M/OSM Antibody

  • MGC20461
  • oncostatin M
  • oncostatin-M
  • OSM

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32744
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
557-NT/CF
Species: Rt
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
AF-249-NA
Species: Hu
Applications: WB, Neut
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
AF662
Species: Mu
Applications: WB, IHC
AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
NBP1-87768
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Oncostatin M/OSM Antibody (NBP1-87768)(1)

Reviews for Oncostatin M/OSM Antibody (NBP1-87768) (0)

There are no reviews for Oncostatin M/OSM Antibody (NBP1-87768). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Oncostatin M/OSM Antibody (NBP1-87768) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Oncostatin M/OSM Products

Bioinformatics Tool for Oncostatin M/OSM Antibody (NBP1-87768)

Discover related pathways, diseases and genes to Oncostatin M/OSM Antibody (NBP1-87768). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Oncostatin M/OSM Antibody (NBP1-87768)

Discover more about diseases related to Oncostatin M/OSM Antibody (NBP1-87768).
 

Pathways for Oncostatin M/OSM Antibody (NBP1-87768)

View related products by pathway.

PTMs for Oncostatin M/OSM Antibody (NBP1-87768)

Learn more about PTMs related to Oncostatin M/OSM Antibody (NBP1-87768).
 

Research Areas for Oncostatin M/OSM Antibody (NBP1-87768)

Find related products by research area.

Blogs on Oncostatin M/OSM

There are no specific blogs for Oncostatin M/OSM, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Oncostatin M/OSM Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OSM
Entrez
Uniprot