Olig3 Antibody

Images

 
Immunohistochemistry-Paraffin: Olig3 Antibody [NBP1-88627] - Staining of human lateral ventricle shows moderate nuclear positivity in subsets of glial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Olig3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NSDSSSVSSRASSPDMDEMYLRDHHHRHHHHQESRLNSVSSTQGDMMQKMPGESLSRAGAKAAGESSKYKIKKQLSEQDLQQLRLKINGR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OLIG3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Olig3 Protein (NBP1-88627PEP)
Publications
Read Publication using
NBP1-88627 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Chicken reactivity reported in scientific literature (PMID: 25026549).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Olig3 Antibody

  • BHLHB7
  • BHLHE20
  • bHLHe20oligo3
  • Class B basic helix-loop-helix protein 7
  • Class E basic helix-loop-helix protein 20
  • Olig3
  • Oligo3
  • oligodendrocyte transcription factor 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2418
Species: Hu
Applications: WB, IHC, ChIP, ICC
NBP1-77533
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-P, IP, CyTOF-ready
MAB2417
Species: Hu, Mu
Applications: WB, IHC
NBP1-47871
Species: Hu, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB3428
Species: Hu
Applications: WB, IHC
NBP1-31318
Species: Mu
Applications: IHC-P
AF2567
Species: Mu
Applications: WB, IHC
NBP2-00851
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56170
Species: Hu, Bv, Ca
Applications: WB, IHC, IHC-P, IP
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
MAB3314
Species: Hu, Rt
Applications: IHC
NBP1-82554
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-61007
Species: Hu, Alp, AB, Bv, Ca, Eq, Fe, Ft, Gt, Ha, Ll, Mn, Rb, Sh, WB
Applications: Flow, Func, IHC
NBP2-14093
Species: Hu
Applications: WB, IHC, IHC-P
H00003125-B02P
Species: Hu
Applications: WB, Flow
NBP2-30536
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-1147
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, IHC-P, Flow-CS
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
AF4940
Species: Hu, Mu
Applications: ICC

Publications for Olig3 Antibody (NBP1-88627)(1)

We have publications tested in 1 confirmed species: Chicken.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Chicken
(1)
All Species

Reviews for Olig3 Antibody (NBP1-88627) (0)

There are no reviews for Olig3 Antibody (NBP1-88627). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Olig3 Antibody (NBP1-88627) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Olig3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OLIG3
Entrez