OLFM4 Antibody

Images

 
Western Blot: OLFM4 Antibody [NBP1-57970] - Jurkat cell lysate, concentration 5.0ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

OLFM4 Antibody Summary

Immunogen
Synthetic peptides corresponding to OLFM4(olfactomedin 4) The peptide sequence was selected from the C terminal of OLFM4. Peptide sequence EEIFYYYDTNTGKEGKLDIVMHKMQEKVQSINYNPFDQKLYVYNDGYLLN.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OLFM4
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against OLFM4 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for OLFM4 Antibody

  • Antiapoptotic protein GW112
  • bA209J19.1
  • GC1
  • G-CSF-stimulated clone 1 protein
  • GW112
  • GW112hOLfD
  • hGC-1
  • KIAA4294
  • olfactomedin 4
  • Olfactomedin-4
  • OlfD
  • OLFM4
  • OLM4
  • UNQ362

Background

OLFM4 is a member of the olfactomedin-related protein family. The exact function of its gene has not yet been determined.This gene was originally cloned from human myeloblasts and found to be selectively expressed in inflammed colonic epithelium. The protein encoded is a member of the olfactomedin-related protein family. The exact function of this gene has not yet been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBL1-16053
Species: Hu
H00002978-R01V
Species: Hu
H00003000-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
AF1379
Species: Hu
Applications: WB, IHC
NBP1-90050
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-5422
Species: Bv
Applications: WB, ELISA, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-46231
Species: Hu
Applications: WB, IHC
AF4478
Species: Hu
Applications: WB, IHC
AF3235
Species: Hu, Mu, Rt
Applications: WB, IHC

Publications for OLFM4 Antibody (NBP1-57970) (0)

There are no publications for OLFM4 Antibody (NBP1-57970).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OLFM4 Antibody (NBP1-57970) (0)

There are no reviews for OLFM4 Antibody (NBP1-57970). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OLFM4 Antibody (NBP1-57970) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional OLFM4 Products

Bioinformatics Tool for OLFM4 Antibody (NBP1-57970)

Discover related pathways, diseases and genes to OLFM4 Antibody (NBP1-57970). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OLFM4 Antibody (NBP1-57970)

Discover more about diseases related to OLFM4 Antibody (NBP1-57970).
 

Pathways for OLFM4 Antibody (NBP1-57970)

View related products by pathway.

PTMs for OLFM4 Antibody (NBP1-57970)

Learn more about PTMs related to OLFM4 Antibody (NBP1-57970).

Blogs on OLFM4

There are no specific blogs for OLFM4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OLFM4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OLFM4
Entrez
Uniprot