Olfactory receptor 139 Antibody


Western Blot: Olfactory receptor 139 Antibody [NBP3-10258] - Western blot analysis of Olfactory receptor 139 in Mouse Lung lysates. Antibody dilution at 1ug/ml

Product Details

Reactivity MuSpecies Glossary
Applications WB

Order Details

Olfactory receptor 139 Antibody Summary

The immunogen is a synthetic peptide directed towards the C terminal region of mouse Olfactory receptor 139 (NP_667214.1). Peptide sequence LGSVSASDKDKGIGILNTILSPMLNPLIYSLRNPDVQGALKRVLTGKRYP
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS buffer, 2% sucrose.
0.09% Sodium Azide
Affinity purified

Alternate Names for Olfactory receptor 139 Antibody

  • M5
  • MOR255
  • MOR255-2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu(-), Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA

Publications for Olfactory receptor 139 Antibody (NBP3-10258) (0)

There are no publications for Olfactory receptor 139 Antibody (NBP3-10258).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Olfactory receptor 139 Antibody (NBP3-10258) (0)

There are no reviews for Olfactory receptor 139 Antibody (NBP3-10258). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Olfactory receptor 139 Antibody (NBP3-10258) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Olfactory receptor 139 Products

Bioinformatics Tool for Olfactory receptor 139 Antibody (NBP3-10258)

Discover related pathways, diseases and genes to Olfactory receptor 139 Antibody (NBP3-10258). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on Olfactory receptor 139

There are no specific blogs for Olfactory receptor 139, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Olfactory receptor 139 Antibody and receive a gift card or discount.


Gene Symbol Olfr139