Olfactory Marker Protein Antibody


Western Blot: Olfactory Marker Protein Antibody [NBP1-74172] - Mouse Heart Lysate 1ug/ml Gel Concentration 10-20%

Product Details

Product Discontinued
View other related Olfactory Marker Protein Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Olfactory Marker Protein Antibody Summary

Synthetic peptides corresponding to the C terminal of Omp. Immunizing peptide sequence EDSDAMDWNEADALEFGERLSDLAKIRKVMYFLITFGEGVEPANLKASVV.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Omp and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Olfactory Marker Protein Antibody

  • olfactory marker protein
  • Olfactory neuronal-specific protein


Omp may act as a modulator of the olfactory signal-transduction cascade.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Av, Bv, Fi, Gt, Ma, Re
Applications: WB, ELISA, IHC
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Ca
Applications: WB, IHC, ICC
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu

Publications for Olfactory Marker Protein Antibody (NBP1-74172) (0)

There are no publications for Olfactory Marker Protein Antibody (NBP1-74172).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Olfactory Marker Protein Antibody (NBP1-74172) (0)

There are no reviews for Olfactory Marker Protein Antibody (NBP1-74172). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Olfactory Marker Protein Antibody (NBP1-74172) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Olfactory Marker Protein Products

Bioinformatics Tool for Olfactory Marker Protein Antibody (NBP1-74172)

Discover related pathways, diseases and genes to Olfactory Marker Protein Antibody (NBP1-74172). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Olfactory Marker Protein Antibody (NBP1-74172)

Discover more about diseases related to Olfactory Marker Protein Antibody (NBP1-74172).

Pathways for Olfactory Marker Protein Antibody (NBP1-74172)

View related products by pathway.

PTMs for Olfactory Marker Protein Antibody (NBP1-74172)

Learn more about PTMs related to Olfactory Marker Protein Antibody (NBP1-74172).

Blogs on Olfactory Marker Protein.

Novus Knows the Nose: Sniffing Out the Olfactory Pathway
The process of smelling, also known as olfaction, involves thousands of olfactory receptors that transmit signals to the brain. Learn more about the olfactory process in the infographic below.Novus Biologicals offers olfactory related research rea...  Read full blog post.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Olfactory Marker Protein Antibody and receive a gift card or discount.


Gene Symbol OMP