OGFOD1 Antibody


Western Blot: OGFOD1 Antibody [NBP1-54815] - DU145 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Product Discontinued
View other related OGFOD1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

OGFOD1 Antibody Summary

Synthetic peptides corresponding to OGFOD1(2-oxoglutarate and iron-dependent oxygenase domain containing 1) The peptide sequence was selected from the middle region of OGFOD1. Peptide sequence GCEGWEPEYGGFTSYIAKGEDEELLTVNPESNSLALVYRDRETLKF
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against OGFOD1 and was validated on Western blot.
Theoretical MW
63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for OGFOD1 Antibody

  • 2-oxoglutarate and iron-dependent oxygenase domain containing 1,2-oxoglutarate and iron-dependent oxygenase domain-containing protein 1
  • EC 1.14.11
  • FLJ10826
  • KIAA1612TPA1, termination and polyadenylation 1, homolog
  • Termination and polyadenylation 1 homolog
  • TPA1EC 1.14.11.-


The specific function of this protein remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, ICC

Publications for OGFOD1 Antibody (NBP1-54815) (0)

There are no publications for OGFOD1 Antibody (NBP1-54815).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OGFOD1 Antibody (NBP1-54815) (0)

There are no reviews for OGFOD1 Antibody (NBP1-54815). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OGFOD1 Antibody (NBP1-54815) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional OGFOD1 Products

Bioinformatics Tool for OGFOD1 Antibody (NBP1-54815)

Discover related pathways, diseases and genes to OGFOD1 Antibody (NBP1-54815). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OGFOD1 Antibody (NBP1-54815)

Discover more about diseases related to OGFOD1 Antibody (NBP1-54815).

Pathways for OGFOD1 Antibody (NBP1-54815)

View related products by pathway.

PTMs for OGFOD1 Antibody (NBP1-54815)

Learn more about PTMs related to OGFOD1 Antibody (NBP1-54815).

Research Areas for OGFOD1 Antibody (NBP1-54815)

Find related products by research area.

Blogs on OGFOD1

There are no specific blogs for OGFOD1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our OGFOD1 Antibody and receive a gift card or discount.


Gene Symbol OGFOD1