ODR4/TTG1 Antibody

Images

 
Western Blot: ODR4/TTG1 Antibody [NBP1-82177] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: ODR4/TTG1 Antibody [NBP1-82177] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane.
Immunohistochemistry-Paraffin: ODR4/TTG1 Antibody [NBP1-82177] - Staining of human pancreas shows distinct cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ODR4/TTG1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FHVLPYRVFVPLPGSTVMLCDYKFDDESAEEIRDHFMEMLDHTIQIEDLEIAEETNTACMSSSMNSQASLDNTDDEQPKQPIK
Specificity
Specificity of human, mouse ODR4/TTG1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C1ORF27
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval method is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Reactivity Notes

Rat (78%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ODR4/TTG1 Antibody

  • chromosome 1 open reading frame 27
  • FLJ20505
  • hODR-4
  • LAG1-interacting protein
  • odorant response abnormal 4
  • ODR4
  • odr-4
  • protein odr-4 homolog
  • Transactivated by transforming growth factor beta protein 1
  • TTG1
  • TTG1A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80306
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB, IHC, IHC-P, KD
NBP2-31564
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
NBP2-65749
Species: Hu
NB110-83978
Species: Hu, Mu, Rt, Bv
Applications: WB, ChIP, IHC, IHC-P
NB110-57150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-33930
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-47272
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-56533
Species: Hu
Applications: ICC/IF
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP2-67471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00005555-P01
Species: Hu
NBP2-23368
Species: Hu
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-55534
Species: Hu
Applications: WB, ICC/IF
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-82855
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92589
Species: Hu, Dr
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58906
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for ODR4/TTG1 Antibody (NBP1-82177) (0)

There are no publications for ODR4/TTG1 Antibody (NBP1-82177).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ODR4/TTG1 Antibody (NBP1-82177) (0)

There are no reviews for ODR4/TTG1 Antibody (NBP1-82177). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ODR4/TTG1 Antibody (NBP1-82177) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ODR4/TTG1 Products

Bioinformatics Tool for ODR4/TTG1 Antibody (NBP1-82177)

Discover related pathways, diseases and genes to ODR4/TTG1 Antibody (NBP1-82177). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ODR4/TTG1 Antibody (NBP1-82177)

Discover more about diseases related to ODR4/TTG1 Antibody (NBP1-82177).
 

Pathways for ODR4/TTG1 Antibody (NBP1-82177)

View related products by pathway.

Blogs on ODR4/TTG1

There are no specific blogs for ODR4/TTG1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ODR4/TTG1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C1ORF27