OCT4 Antibody (3A10)


Western Blot: OCT4 Antibody (3A10) [H00005460-M04] - Analysis of POU5F1 expression in HepG2 (Cat # L019V1).
Western Blot: OCT4 Antibody (3A10) [H00005460-M04] - Analysis of POU5F1 expression in transfected 293T cell line by POU5F1 monoclonal antibody (M04), clone 3A10. Lane 1: POU5F1 transfected lysatE (18.3 KDa). Lane 2: ...read more

Product Details

Product Discontinued
View other related OCT4 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

OCT4 Antibody (3A10) Summary

POU5F1 (AAH20712, 81 a.a. - 164 a.a.) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. WFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN
Embryonic Stem Cell Marker
POU5F1 (3A10)
IgG2a Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for OCT4 Antibody (3A10)

  • class 5, transcription factor 1
  • MGC22487
  • Oct-3
  • OCT3Oct4
  • Oct-4
  • Octamer-binding protein 3
  • otc-4
  • OTF3POU domain class 5, transcription factor 1
  • OTF4
  • POU class 5 homeobox 1
  • POU-type homeodomain-containing DNA-binding protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ChIP, ICC
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
Species: Mu
Applications: WB, ChIP, ICC
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, IP, ChIP, ICC
Species: Hu
Applications: WB, ICC
Species: Hu, Mu, Rt, Po
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu
Applications: WB, IHC, IHC-P

Publications for OCT4 Antibody (H00005460-M04) (0)

There are no publications for OCT4 Antibody (H00005460-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OCT4 Antibody (H00005460-M04) (0)

There are no reviews for OCT4 Antibody (H00005460-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OCT4 Antibody (H00005460-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional OCT4 Products

Bioinformatics Tool for OCT4 Antibody (H00005460-M04)

Discover related pathways, diseases and genes to OCT4 Antibody (H00005460-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OCT4 Antibody (H00005460-M04)

Discover more about diseases related to OCT4 Antibody (H00005460-M04).

Pathways for OCT4 Antibody (H00005460-M04)

View related products by pathway.

PTMs for OCT4 Antibody (H00005460-M04)

Learn more about PTMs related to OCT4 Antibody (H00005460-M04).

Research Areas for OCT4 Antibody (H00005460-M04)

Find related products by research area.

Blogs on OCT4.

Application Focus: New Methods for iPSC Differentiation, Inducing a Mammary Fate
Discovery of the Key to PluripotencyInduced pluripotent stem cells (iPSCs) may be generated from a wide range of fully differentiated cells, and under optimal conditions may be prompted to differentiate into virtu...  Read full blog post.

Stemness for Surviving Hypoxia: TGF-beta/Smad Signaling in Multiple Myeloma
By Jamshed Arslan Pharm.D. Multiple myeloma (MM) is a cancer of antibody-producing plasma cells. The bone marrow (BM) of MM patients is hypoxic, and MM cells overexpress many cancerous genes that are regulated by hy...  Read full blog post.

Nanog is a Master Controller of ES cell Pluripotency
Nanog, a homeodomain (HD) transcription factor, plays a critical role in the maintenance of embryonic stem (ES) cell self-renewal. Transcription regulator involved in inner cell mass and ES cell proliferation and self-renewal. Imposes pluripotency on...  Read full blog post.

Histones, Bmi1 & OCT4: Investigating the Secrets of ESC Pluripotency
Epigenetic alterations have come to prominence in biomedical research. In particular, hypermethylation of CpG islands located in the promoter regions of tumor-suppressor genes is now firmly established as an important mechanism for gene inactivation i...  Read full blog post.

Sox2 and Oct4: Roles in Embryonic Stem Cell Pluripotency
Embryonic stem (ES) cells are cells derived from the inner cell mass of the blastocyst, an early-stage embryo. ES cells are distinguished from other cells due to their pluripotency, which is the ability to differentiate into any different type of cell...  Read full blog post.

An Unlikely Pairing: The SOX2 Antibody and Breast Cancer
SOX2 encodes a member of the SOX (SRY-related HMG-box) family of transcription factors, which play a vital role in embryonic development. SOX2 antibody research has identified Sox2 as a key transcription factor in pluripotent stem cells. We at Novus B...  Read full blog post.

The Sox2 Antibody Aids Brain Cancer Research
The Sox2 antibody is widely used in sensory, neuroscience and stem cell marker research. Recently, Sox2 antibody preparations identified the Sox2 protein as a marker for malignant neural gliomas. We at Novus Biologicals offer a wide variety of highly...  Read full blog post.

Not as Pluripotent as You Used to Be: Embryonic Stem Cell Markers and the Aging Process
We at Novus Biologicals recently extended our antibody catalog to include several embryonic stem cells (ESC) antibodies validated for use in FACS (fluorescent activated cell sorting) assays. Among them was Oct4, which recently became the focus of an i...  Read full blog post.

Fluorescence Activated Cell Sorting Antibody Techniques
Recently, we at Novus Biologicals added several embryonic stem cell marker products to our antibody catalog, validated for use in fluorescent activated cell sorting (FACS) assays. They included Cripto1, PODXL, SSEA, OCT4, Nanog, SOX2, TRA-1, TERT and...  Read full blog post.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our OCT4 Antibody (3A10) and receive a gift card or discount.


Gene Symbol POU5F1