OCIAD2 Antibody

Images

 
Western Blot: OCIAD2 Antibody [NBP1-70662] - Titration: 0.2-1 ug/ml, Positive Control: 293T cell lysate.

Product Details

Summary
Product Discontinued
View other related OCIAD2 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-70662
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

OCIAD2 Antibody Summary

Immunogen
Synthetic peptides corresponding to OCIAD2(OCIA domain containing 2) The peptide sequence was selected from the middle region of OCIAD2. Peptide sequence QGYLAANSRFGSLPKVALAGLLGFGLGKVSYIGVCQSKFHFFEDQLRGAG.
Clonality
Polyclonal
Host
Rabbit
Gene
OCIAD2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against OCIAD2 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for OCIAD2 Antibody

  • MGC45416
  • OCIA domain containing 2
  • OCIA domain-containing protein 2
  • ovarian carcinoma immunoreactive antigen
  • ovarian carcinoma immunoreactive antigen-like protein

Background

The exact function of OCIAD2 is not known.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56393
Species: Hu
Applications: WB
NBP2-46231
Species: Hu
Applications: WB, IHC
AF1227
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
AF4478
Species: Hu
Applications: WB, IHC
NBP1-92218
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005670-T01
Species: Hu
NBP1-31310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-70662
Species: Hu
Applications: WB

Publications for OCIAD2 Antibody (NBP1-70662) (0)

There are no publications for OCIAD2 Antibody (NBP1-70662).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OCIAD2 Antibody (NBP1-70662) (0)

There are no reviews for OCIAD2 Antibody (NBP1-70662). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OCIAD2 Antibody (NBP1-70662) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional OCIAD2 Products

Bioinformatics Tool for OCIAD2 Antibody (NBP1-70662)

Discover related pathways, diseases and genes to OCIAD2 Antibody (NBP1-70662). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OCIAD2 Antibody (NBP1-70662)

Discover more about diseases related to OCIAD2 Antibody (NBP1-70662).

Blogs on OCIAD2

There are no specific blogs for OCIAD2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OCIAD2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OCIAD2