Occludin Antibody (1G7) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related Occludin Primary Antibodies

Order Details


    • Catalog Number
      H00004950-M01G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Occludin Antibody (1G7) [DyLight 488] Summary

Immunogen
OCLN (NP_002529 423 a.a. - 522 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT
Marker
Tight Junctions Marker
Specificity
OCLN - occludin
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
OCLN
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunoprecipitation

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Occludin Antibody (1G7) [DyLight 488]

  • BLCPMG
  • Occludin
  • OCLN

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
H00009076-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NB120-15106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-41187
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
MAB4620
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-49230
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74633
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP1-86850
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Occludin Antibody (H00004950-M01G) (0)

There are no publications for Occludin Antibody (H00004950-M01G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Occludin Antibody (H00004950-M01G) (0)

There are no reviews for Occludin Antibody (H00004950-M01G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Occludin Antibody (H00004950-M01G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Occludin Products

Bioinformatics Tool for Occludin Antibody (H00004950-M01G)

Discover related pathways, diseases and genes to Occludin Antibody (H00004950-M01G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Occludin Antibody (H00004950-M01G)

Discover more about diseases related to Occludin Antibody (H00004950-M01G).
 

Pathways for Occludin Antibody (H00004950-M01G)

View related products by pathway.

PTMs for Occludin Antibody (H00004950-M01G)

Learn more about PTMs related to Occludin Antibody (H00004950-M01G).

Blogs on Occludin

There are no specific blogs for Occludin, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Occludin Antibody (1G7) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol OCLN
Entrez