OAS1 Antibody (2D4) [DyLight 350]

Images

 

Product Details

Summary
Product Discontinued
View other related OAS1 Primary Antibodies

Order Details


    • Catalog Number
      H00004938-M01UV
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

OAS1 Antibody (2D4) [DyLight 350] Summary

Immunogen
OAS1 (AAH00562, 1 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SVSRRDKSKQVWEAVLLPLSLLSMMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDAD
Specificity
OAS1 (2D4)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
OAS1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for OAS1 Antibody (2D4) [DyLight 350]

  • (2-5')oligo(A) synthase 1,2'-5'-oligoadenylate synthetase 1,2-5A synthase 1,2'-5'-oligoisoadenylate synthetase 1
  • (2-5')oligo(A) synthetase 1
  • 2'-5'-oligo A synthetase 1
  • 2'-5'-oligoadenylate synthase 1
  • 2'-5'-oligoadenylate synthetase 1 (40-46 kD)
  • 2'-5'-oligoadenylate synthetase 1, 40/46kDa
  • E18/E16,2-5A synthetase 1
  • EC 2.7.7
  • EC 2.7.7.-
  • IFI-4,2'-5' oligoadenylate synthetase 1 p52 isoform
  • OIAS2'-5' oligoadenylate synthetase 1 p48 isoform
  • OIASI
  • p46/p42 OAS

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47859
Species: Hu, Mu, Mk
Applications: WB, ICC/IF
AF5550
Species: Mu, Rt
Applications: WB
MAB1925
Species: Hu
Applications: IP, ICC
NB100-351
Species: Hu, Ha, Pm, Mu(-), Rt(-)
Applications: WB, ELISA, IHC, IHC-P
AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
NBP1-85841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87363
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77266
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
AF8519
Species: Hu, Mu, Rt
Applications: WB
NBP2-02340
Species: Hu, Mu, Rt, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF5629
Species: Hu, Mu
Applications: WB
NBP2-24875
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-27109
Species: Hu, Mu, Po, Pm
Applications: WB, Simple Western, IHC, IHC-P
NBP1-77263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00004938-M01UV
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP

Publications for OAS1 Antibody (H00004938-M01UV) (0)

There are no publications for OAS1 Antibody (H00004938-M01UV).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OAS1 Antibody (H00004938-M01UV) (0)

There are no reviews for OAS1 Antibody (H00004938-M01UV). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for OAS1 Antibody (H00004938-M01UV) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional OAS1 Products

Bioinformatics Tool for OAS1 Antibody (H00004938-M01UV)

Discover related pathways, diseases and genes to OAS1 Antibody (H00004938-M01UV). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OAS1 Antibody (H00004938-M01UV)

Discover more about diseases related to OAS1 Antibody (H00004938-M01UV).
 

Pathways for OAS1 Antibody (H00004938-M01UV)

View related products by pathway.

PTMs for OAS1 Antibody (H00004938-M01UV)

Learn more about PTMs related to OAS1 Antibody (H00004938-M01UV).
 

Research Areas for OAS1 Antibody (H00004938-M01UV)

Find related products by research area.

Blogs on OAS1

There are no specific blogs for OAS1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OAS1 Antibody (2D4) [DyLight 350] and receive a gift card or discount.

Bioinformatics

Gene Symbol OAS1