NYS48 Antibody (NBP1-92217)

Images

 
Immunohistochemistry: NYS48 Antibody [NBP1-92217] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NYS48 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ATRFKEQYRTFATALDTTRHELPVRSIHLEGDGQQLLDALQHELVTTQRLLGELDVGDSEENVQVLDLLSELKDVTAKKDLELRRSFAQVLELS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HAUS8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
Control Peptide
NYS48 Protein (NBP1-92217PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NYS48 Antibody

  • DGT4
  • HAUS augmin-like complex subunit 8
  • HAUS augmin-like complex, subunit 8
  • HEC1/NDC80 interacting, centrosome associated 1
  • Hec1-interacting and centrosome-associated 1
  • HICE1HEC1/NDC80-interacting centrosome-associated protein 1
  • MGC20533
  • NY-SAR-48
  • Sarcoma antigen NY-SAR-48

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
H00121441-M05
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NB100-338
Species: Hu, Mu, Rt, Po, Ha, Mk
Applications: WB, Flow, ICC/IF, IHC, IP
AF4185
Species: Hu
Applications: ICC
NBP1-31541
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31632
Species: Hu
Applications: WB, ICC/IF
NBP1-83936
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16416
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32775
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-89979
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-563
Species: Hu
Applications: WB, IHC-P, IP
NBP1-51843
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-92217
Species: Hu
Applications: IHC, IHC-P

Publications for NYS48 Antibody (NBP1-92217) (0)

There are no publications for NYS48 Antibody (NBP1-92217).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NYS48 Antibody (NBP1-92217) (0)

There are no reviews for NYS48 Antibody (NBP1-92217). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NYS48 Antibody (NBP1-92217) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NYS48 Products

Related Products by Gene

Bioinformatics Tool for NYS48 Antibody (NBP1-92217)

Discover related pathways, diseases and genes to NYS48 Antibody (NBP1-92217). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on NYS48

There are no specific blogs for NYS48, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NYS48 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HAUS8