Nurim Antibody

Images

 
Western Blot: Nurim Antibody [NBP2-87942] - Host: Rabbit. Target Name: NRM. Sample Tissue: Human Jurkat Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Nurim Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human Nurim. Peptide sequence: LTVLWVVPTLGTDRLLLAFLLTLYLGLAHGLDQQDLRYLRAQLQRKLHLL The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
NRM
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Nurim Antibody

  • NRM29Nuclear envelope membrane protein
  • Nuclear rim protein
  • nurim (nuclear envelope membrane protein)
  • nurim

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-05061
Species: Hu, Mu
Applications: ICC/IF, WB
MAB5285
Species: Hu
Applications: Simple Western, WB
NBP1-82558
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-82486
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-86615
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP1-89827
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00171023-M05
Species: Hu
Applications: ELISA, IP, WB
NBP2-75656
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-P, WB
NBP1-87769
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-29460
Species: Pm, Pm-Cm, Hu, Pm, RM
Applications: Flow, ICC/IF, IHC, IHC-P, ISH
NBP2-31993
Species: Hu
Applications: IHC, IHC-P, WB
NB600-1071
Species: Hu(-), Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
NBP1-92172
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
AF5665
Species: Mu, Rt
Applications: IHC, WB
H00003126-P01
Species: Hu
Applications: ELISA, AP, PA, WB

Publications for Nurim Antibody (NBP2-87942) (0)

There are no publications for Nurim Antibody (NBP2-87942).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nurim Antibody (NBP2-87942) (0)

There are no reviews for Nurim Antibody (NBP2-87942). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nurim Antibody (NBP2-87942) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Nurim Products

Bioinformatics Tool for Nurim Antibody (NBP2-87942)

Discover related pathways, diseases and genes to Nurim Antibody (NBP2-87942). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nurim Antibody (NBP2-87942)

Discover more about diseases related to Nurim Antibody (NBP2-87942).
 

Pathways for Nurim Antibody (NBP2-87942)

View related products by pathway.

PTMs for Nurim Antibody (NBP2-87942)

Learn more about PTMs related to Nurim Antibody (NBP2-87942).

Blogs on Nurim

There are no specific blogs for Nurim, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nurim Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NRM