NUP88 Antibody

Images

 
Western Blot: NUP88 Antibody [NBP2-83294] - Host: Rabbit. Target Name: NUP88. Sample Tissue: Human ACHN Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NUP88 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle terminal region of human NUP88. Peptide sequence: CPSRYHCTHEAGVHSVGLTWIHKLHKFLGSDEEDKDSLQELSTEQKCFVE The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
NUP88
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NUP88 Antibody

  • karyoporin
  • nucleoporin 88kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2244
Species: Hu
Applications: IHC, IHC-P, IP, WB
NB400-148
Species: ChHa, Ha, Hu, Mu, Po, Pm, Rt
Applications: EM, ICC/IF, IHC, IHC-P, IP, KD, KO, WB
NB120-2938
Species: Bv, Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-83213
Species: Hu
Applications: IHC, IHC-P, WB
NB100-93325
Species: Hu
Applications: ICC/IF, IP, WB
NB100-79802
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NB100-93329
Species: Hu
Applications: ICC/IF, IP, KO, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
NBP2-19561
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF2699
Species: Hu, Mu
Applications: ChIP, ICC, Simple Western, WB
NBP1-76544
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP1-88866
Species: Hu
Applications: IHC, IHC-P
NBP1-31381
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-76926
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP2-75729
Species: Hu
Applications: IHC, IHC-P, PA, WB
NB110-61646
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-28566
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr, IHC-P, WB
NBP2-83294
Species: Hu
Applications: WB

Publications for NUP88 Antibody (NBP2-83294) (0)

There are no publications for NUP88 Antibody (NBP2-83294).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NUP88 Antibody (NBP2-83294) (0)

There are no reviews for NUP88 Antibody (NBP2-83294). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NUP88 Antibody (NBP2-83294) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NUP88 Products

Bioinformatics Tool for NUP88 Antibody (NBP2-83294)

Discover related pathways, diseases and genes to NUP88 Antibody (NBP2-83294). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NUP88 Antibody (NBP2-83294)

Discover more about diseases related to NUP88 Antibody (NBP2-83294).
 

Pathways for NUP88 Antibody (NBP2-83294)

View related products by pathway.

PTMs for NUP88 Antibody (NBP2-83294)

Learn more about PTMs related to NUP88 Antibody (NBP2-83294).

Blogs on NUP88

There are no specific blogs for NUP88, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NUP88 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NUP88