Nup53 Antibody

Images

 
Western Blot: Nup53 Antibody [NBP1-53062] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related Nup53 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-53062
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Nup53 Antibody Summary

Immunogen
Synthetic peptides corresponding to NUP35(nucleoporin 35kDa) The peptide sequence was selected from the C terminal of NUP35. Peptide sequence STPRISTMRPLATAYKASTSDYQVISDRQTPKKDESLVSKAMEYMFGW.
Clonality
Polyclonal
Host
Rabbit
Gene
NUP35
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against NUP35 and was validated on Western blot.
Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Nup53 Antibody

  • 35 kDa nucleoporin
  • Mitotic phosphoprotein 44
  • MP-44
  • MP44NUP53
  • NP44
  • Nuclear pore complex protein Nup53
  • nucleoporin 35kDa
  • Nucleoporin Nup35
  • nucleoporin NUP53

Background

NUP35 is a member of the nucleoporin family. The protein is localized to the nuclear rim and is part of the nuclear pore complex (NPC). All molecules entering or leaving the nucleus either diffuse through or are actively transported by the NPC. This gene encodes a member of the nucleoporin family. The protein is localized to the nuclear rim and is part of the nuclear pore complex (NPC). All molecules entering or leaving the nucleus either diffuse through or are actively transported by the NPC.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP1-81546
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-82960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83213
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91247
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-76926
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00003843-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP1-32775
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
MAB5979
Species: Hu
Applications: WB, IP
NBP1-85550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89979
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00003930-B01P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
NBP1-31776
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-57100
Species: Hu
Applications: ICC/IF
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-91603
Species: Hu
Applications: WB
NBP1-53062
Species: Hu
Applications: WB

Publications for Nup53 Antibody (NBP1-53062) (0)

There are no publications for Nup53 Antibody (NBP1-53062).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nup53 Antibody (NBP1-53062) (0)

There are no reviews for Nup53 Antibody (NBP1-53062). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nup53 Antibody (NBP1-53062) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Nup53 Products

Bioinformatics Tool for Nup53 Antibody (NBP1-53062)

Discover related pathways, diseases and genes to Nup53 Antibody (NBP1-53062). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for Nup53 Antibody (NBP1-53062)

View related products by pathway.

Blogs on Nup53

There are no specific blogs for Nup53, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nup53 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NUP35
Uniprot