We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

NUP50 Recombinant Protein Antigen

Images

 
There are currently no images for NUP50 Recombinant Protein Antigen (NBP2-57627PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

NUP50 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NUP50.

Source: E. coli

Amino Acid Sequence: NAEKELTDRNWDQEDEAEEVGTFSMASEEVLKNRAIKKAKR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NUP50
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57627.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NUP50 Recombinant Protein Antigen

  • 50 kDa nucleoporin
  • MGC39961
  • NPAP60
  • NPAP60LNucleoporin Nup50
  • nuclear pore complex protein Nup50
  • Nuclear pore-associated protein 60 kDa-like
  • nuclear pore-associated protein 60L
  • nucleoporin 50kD
  • nucleoporin 50kDa

Background

The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. The protein encoded by this gene is a member of the FG-repeat containing nucleoporins that functions as a soluble cofactor in importin-alpha:beta-mediated nuclear protein import. Pseudogenes of this gene are found on chromosomes 5, 6, and 14. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83213
Species: Hu
Applications: IHC,  IHC-P, WB
NB400-148
Species: ChHa, Ha, Hu, Mu, Po, Pm, Rt
Applications: EM, ICC/IF, IHC,  IHC-P, IP, KD, KO, WB
NB100-93329
Species: Hu
Applications: ICC/IF, IP, KO, WB
H00001434-M08
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-00532
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-45646
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB100-93325
Species: Hu
Applications: ICC/IF, IP, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
AF1555
Species: Hu
Applications: WB
NBP3-47054
Species: Hu, Mu
Applications: ELISA, IHC, WB
NBP2-61832
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-84735
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-81546
Species: Hu, Mu, Rt
Applications:  IHC-P, WB
NBP2-48546
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-45570
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
H00003836-M01
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, IP, WB
NBP1-87712
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-57627PEP
Species: Hu
Applications: AC

Publications for NUP50 Recombinant Protein Antigen (NBP2-57627PEP) (0)

There are no publications for NUP50 Recombinant Protein Antigen (NBP2-57627PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NUP50 Recombinant Protein Antigen (NBP2-57627PEP) (0)

There are no reviews for NUP50 Recombinant Protein Antigen (NBP2-57627PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NUP50 Recombinant Protein Antigen (NBP2-57627PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NUP50 Products

Blogs on NUP50

There are no specific blogs for NUP50, but you can read our latest blog posts.

Customers Who Bought This Also Bought

NUP50 Antibody
NB100-93324

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NUP50 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NUP50