NUP155 Antibody

Images

 
Western Blot: NUP155 Antibody [NBP1-53019] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related NUP155 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-53019
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

NUP155 Antibody Summary

Immunogen
Synthetic peptides corresponding to NUP155(nucleoporin 155kDa) The peptide sequence was selected from the middle region of NUP155. Peptide sequence ISLHLQDICPLLYSTDDAICSKANELLQRSRQVQNKTEKERMLRESLKEY.
Clonality
Polyclonal
Host
Rabbit
Gene
NUP155
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against NUP155 and was validated on Western blot.
Theoretical MW
147 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NUP155 Antibody

  • 155 kDa nucleoporin
  • KIAA0791nucleoporin 155kD
  • N155
  • nuclear pore complex protein Nup155
  • nucleoporin 155kDa
  • Nucleoporin Nup155

Background

Nucleoporins are the main components of the nuclear pore complex (NPC) of eukaryotic cells. They are involved in the bidirectional trafficking of molecules, especially mRNAs and proteins, between the nucleus and the cytoplasm. NUP155 does not contain the typical FG repeat sequences found in most vertebrate nucleoporins.Nucleoporins are the main components of the nuclear pore complex (NPC) of eukaryotic cells. They are involved in the bidirectional trafficking of molecules, especially mRNAs and proteins, between the nucleus and the cytoplasm. The protein encoded by this gene does not contain the typical FG repeat sequences found in most vertebrate nucleoporins. Two protein isoforms are encoded by transcript variants of this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
NB100-93322
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP1-83213
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-76975
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-81546
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF3204
Species: Hu, Mu, Rt
Applications: WB
H00003930-B01P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
NBP2-67817
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-24574
Species: Hu, Mu, Ca, Ch, Eq, Op, Pm, Xp
Applications: WB, IHC-P
NBP1-88591
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-76926
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB100-1894
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-91603
Species: Hu
Applications: WB
H00011097-P01
Species: Hu
NB100-93329
Species: Hu
Applications: WB, ICC/IF, IP, KO

Publications for NUP155 Antibody (NBP1-53019) (0)

There are no publications for NUP155 Antibody (NBP1-53019).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NUP155 Antibody (NBP1-53019) (0)

There are no reviews for NUP155 Antibody (NBP1-53019). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NUP155 Antibody (NBP1-53019) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for NUP155 Antibody (NBP1-53019)

Discover related pathways, diseases and genes to NUP155 Antibody (NBP1-53019). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NUP155 Antibody (NBP1-53019)

Discover more about diseases related to NUP155 Antibody (NBP1-53019).
 

Pathways for NUP155 Antibody (NBP1-53019)

View related products by pathway.

PTMs for NUP155 Antibody (NBP1-53019)

Learn more about PTMs related to NUP155 Antibody (NBP1-53019).

Blogs on NUP155

There are no specific blogs for NUP155, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NUP155 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NUP155
Uniprot