NUDT18 Antibody



Product Details

Product Discontinued
View other related NUDT18 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

NUDT18 Antibody Summary

Synthetic peptides corresponding to NUDT18(nudix (nucleoside diphosphate linked moiety X)-type motif 18) The peptide sequence was selected from the C terminal of NUDT18. Peptide sequence KGLLGLQHLGRDHSDGICLNVLVTVAFRSPGIQDEPPKVRGENFSWWKVM.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


Application Notes
This is a rabbit polyclonal antibody against NUDT18 and was validated on Western blot.


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.


NUDT18 belongs to the Nudix hydrolase family. It contains 1 nudix hydrolase domain. NUDT18 probably mediates the hydrolysis of some nucleoside diphosphate derivatives.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: IHC, IHC-P

Publications for NUDT18 Antibody (NBP1-53055) (0)

There are no publications for NUDT18 Antibody (NBP1-53055).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NUDT18 Antibody (NBP1-53055) (0)

There are no reviews for NUDT18 Antibody (NBP1-53055). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

FAQs for NUDT18 Antibody (NBP1-53055) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NUDT18 Antibody Products

Related Products by Gene

Bioinformatics Tool for NUDT18 Antibody (NBP1-53055)

Discover related pathways, diseases and genes to NUDT18 Antibody (NBP1-53055). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for NUDT18 Antibody (NBP1-53055)

View related products by pathway.

PTMs for NUDT18 Antibody (NBP1-53055)

Learn more about PTMs related to NUDT18 Antibody (NBP1-53055).

Blogs on NUDT18

There are no specific blogs for NUDT18, but you can read our latest blog posts.

Contact Information

Product PDFs


Gene Symbol NUDT18

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-53055 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.