NUDT18 Antibody

Images

 
Western Blot: NUDT18 Antibody [NBP1-53055] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related NUDT18 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-53055
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

NUDT18 Antibody Summary

Immunogen
Synthetic peptides corresponding to NUDT18(nudix (nucleoside diphosphate linked moiety X)-type motif 18) The peptide sequence was selected from the C terminal of NUDT18. Peptide sequence KGLLGLQHLGRDHSDGICLNVLVTVAFRSPGIQDEPPKVRGENFSWWKVM.
Clonality
Polyclonal
Host
Rabbit
Gene
NUDT18
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against NUDT18 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NUDT18 Antibody

  • EC 3.6.1
  • EC 3.6.1.-
  • FLJ22494
  • nucleoside diphosphate-linked moiety X motif 18
  • nudix (nucleoside diphosphate linked moiety X)-type motif 18
  • Nudix motif 18

Background

NUDT18 belongs to the Nudix hydrolase family. It contains 1 nudix hydrolase domain. NUDT18 probably mediates the hydrolysis of some nucleoside diphosphate derivatives.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-109
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-38436
Species: Hu
Applications: IHC, IHC-P

Publications for NUDT18 Antibody (NBP1-53055) (0)

There are no publications for NUDT18 Antibody (NBP1-53055).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NUDT18 Antibody (NBP1-53055) (0)

There are no reviews for NUDT18 Antibody (NBP1-53055). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NUDT18 Antibody (NBP1-53055) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NUDT18 Products

Bioinformatics Tool for NUDT18 Antibody (NBP1-53055)

Discover related pathways, diseases and genes to NUDT18 Antibody (NBP1-53055). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for NUDT18 Antibody (NBP1-53055)

View related products by pathway.

PTMs for NUDT18 Antibody (NBP1-53055)

Learn more about PTMs related to NUDT18 Antibody (NBP1-53055).

Blogs on NUDT18

There are no specific blogs for NUDT18, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NUDT18 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NUDT18
Uniprot