NUDCD3 Antibody

Images

 
Western Blot: NUDCD3 Antibody [NBP1-56365] - Human Thymus lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related NUDCD3 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-56365
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

NUDCD3 Antibody Summary

Immunogen
Synthetic peptides corresponding to NUDCD3(NudC domain containing 3) The peptide sequence was selected from the middle region of NUDCD3. Peptide sequence KINKERSMATVDEEEQAVLDRLTFDYHQKLQGKPQSHELKVHEMLKKGWD.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NUDCD3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against NUDCD3 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NUDCD3 Antibody

  • KIAA1068NudCL
  • NudC domain containing 3
  • nudC domain-containing protein 3
  • NudC-like protein

Background

The product of this gene functions to maintain the stability of dynein intermediate chain. Depletion of this gene product results in aggregation and degradation of dynein intermediate chain, mislocalization of the dynein complex from kinetochores, spindle

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89517
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
AF-252-PB
Species: Hu
Applications: WB, IHC
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NBP2-55678
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88057
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-47266
Species: Hu, Mu
Applications: WB, IP
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC
AF1062
Species: Mu
Applications: WB, IHC, Neut
NBP2-15164
Species: Hu
Applications: WB, ICC/IF
NBP1-76510
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-89614
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06398
Species: Hu, Rt, Pm
Applications: WB, IB, ICC/IF, IHC, IHC-P
NBP1-85589
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85539
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87769
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NUDCD3 Antibody (NBP1-56365) (0)

There are no publications for NUDCD3 Antibody (NBP1-56365).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NUDCD3 Antibody (NBP1-56365) (0)

There are no reviews for NUDCD3 Antibody (NBP1-56365). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NUDCD3 Antibody (NBP1-56365) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NUDCD3 Products

Bioinformatics Tool for NUDCD3 Antibody (NBP1-56365)

Discover related pathways, diseases and genes to NUDCD3 Antibody (NBP1-56365). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for NUDCD3 Antibody (NBP1-56365)

View related products by pathway.

PTMs for NUDCD3 Antibody (NBP1-56365)

Learn more about PTMs related to NUDCD3 Antibody (NBP1-56365).

Blogs on NUDCD3

There are no specific blogs for NUDCD3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NUDCD3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NUDCD3