Nucleoplasmin-2 Antibody

Images

 
Western Blot: Nucleoplasmin-2 Antibody [H00010361-B01P] - Analysis of NPM2 expression in transfected 293T cell line by NPM2 polyclonal antibody. Lane 1: NPM2 transfected lysate(23.54 KDa). Lane 2: Non-transfected ...read more
Immunohistochemistry-Paraffin: Nucleoplasmin-2 Antibody [H00010361-B01P] - Analysis of purified antibody to NPM2 on formalin-fixed paraffin-embedded human adrenal gland. (antibody concentration 3 ug/ml)
Western Blot: Nucleoplasmin-2 Antibody [H00010361-B01P] - analysis of NPM2 expression in transfected 293T cell line by NPM2 MaxPab polyclonal antibody. Lane 1: NPM2 transfected lysate (23.54 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Nucleoplasmin-2 Antibody Summary

Immunogen
NPM2 (NP_877724.1, 1 a.a. - 214 a.a.) full-length human protein. MNLSSASSTEEKAVTTVLWGCELSQERRTWTFRPQLEGKQSCRLLLHTICLGEKAKEEMHRVEILPPANQEDKKMQPVTIASLQASVLPMVSMVGVQLSPPVTFQLRAGSGPVFLSGQERYEASDLTWEEEEEEEGEEEEEEEEDDEDEDADISLEEQSPVKQVKRLVPQKQASVAKKKKLEKEEEEIRASVRDKSPVKKAKATARAKKPGFKK
Specificity
NPM2 - nucleophosmin/nucleoplasmin, 2,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
NPM2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. Has also been used for immunohistochemistry (paraffin).

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Nucleoplasmin-2 Antibody

  • MGC78655
  • nucleophosmin/nucleoplasmin 2
  • nucleoplasmin-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-61646
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-90999
Species: Hu
Applications: IHC, IHC-P, WB
NBL1-17958
Species: Hu
Applications: WB
NBP1-76289
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
H00344018-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-62315
Species: Hu
Applications: WB
NBP2-33910
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
233-FB/CF
Species: Hu
Applications: BA
H00353238-B01P-50ug
Species: Hu
Applications: WB
H00051053-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-46193
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-30830
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-86103
Species: Hu
Applications: IHC, IHC-P
NBP1-30955
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00136541-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-02619
Species: Hu, Pm, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-61118
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
AF7550
Species: Hu
Applications: KO, WB

Publications for Nucleoplasmin-2 Antibody (H00010361-B01P) (0)

There are no publications for Nucleoplasmin-2 Antibody (H00010361-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nucleoplasmin-2 Antibody (H00010361-B01P) (0)

There are no reviews for Nucleoplasmin-2 Antibody (H00010361-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nucleoplasmin-2 Antibody (H00010361-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Nucleoplasmin-2 Products

Bioinformatics Tool for Nucleoplasmin-2 Antibody (H00010361-B01P)

Discover related pathways, diseases and genes to Nucleoplasmin-2 Antibody (H00010361-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nucleoplasmin-2 Antibody (H00010361-B01P)

Discover more about diseases related to Nucleoplasmin-2 Antibody (H00010361-B01P).
 

Pathways for Nucleoplasmin-2 Antibody (H00010361-B01P)

View related products by pathway.

PTMs for Nucleoplasmin-2 Antibody (H00010361-B01P)

Learn more about PTMs related to Nucleoplasmin-2 Antibody (H00010361-B01P).

Blogs on Nucleoplasmin-2

There are no specific blogs for Nucleoplasmin-2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nucleoplasmin-2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NPM2
Entrez
Uniprot