Nuclear Factor Erythroid 2 Related Factor 1 Recombinant Protein Antigen

Order Details


    • Catalog Number
      NBP2-55915PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Nuclear Factor Erythroid 2 Related Factor 1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Nuclear Factor Erythroid 2 Related Factor 1.

Source: E. coli

Amino Acid Sequence: FDYSHRQKEQDVEKELRDGGEQDTWAGEGAEALARNLLVDGETGESFPAQVPSGEDQTALSL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NFE2L1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55915.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Nuclear Factor Erythroid 2 Related Factor 1 Recombinant Protein Antigen

  • FLJ00380
  • HBZ17
  • LCR-F1
  • Locus control region-factor 1
  • NF-E2-related factor 1
  • NFE2-related factor 1
  • NRF1TCF11
  • nuclear factor (erythroid-derived 2)-like 1
  • nuclear factor erythroid 2-related factor 1
  • Nuclear factor, erythroid derived 2, like 1
  • TCF-11
  • transcription factor 11 (basic leucine zipper type)
  • Transcription factor 11
  • Transcription factor HBZ17
  • Transcription factor LCR-F1

Background

Nuclear Factor Erythroid 2 Related Factor 1 is a 772 amino acid transcription factor. It interacts with KEAP1 and activates globin gene expression in erythrocytes. It may play a role in hepatits and anemia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32822
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, Flow, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NBP1-71648
Species: Hu, Mu(-)
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-32105
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
NBP1-82580
Species: Hu
Applications: IHC,  IHC-P, Simple Western, WB
NBP1-04676
Species: Gt, Ha, Hu, Mu, Po, Rt, Sh, Sq
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, Simple Western, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP2-24551
Species: Bv, Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
H00002729-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP3-29103
Species: Hu
Applications: IHC, IP, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NB600-233
Species: Hu, Mu
Applications: ChIP, CHIP-SEQ, IHC,  IHC-P, IP, WB
H00003043-M02
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, WB
3047-CC
Species: Hu
Applications: BA
DYC2510-2
Species: Hu, Mu, Rt
Applications: ELISA

Publications for Nuclear Factor Erythroid 2 Related Factor 1 Recombinant Protein Antigen (NBP2-55915PEP) (0)

There are no publications for Nuclear Factor Erythroid 2 Related Factor 1 Recombinant Protein Antigen (NBP2-55915PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nuclear Factor Erythroid 2 Related Factor 1 Recombinant Protein Antigen (NBP2-55915PEP) (0)

There are no reviews for Nuclear Factor Erythroid 2 Related Factor 1 Recombinant Protein Antigen (NBP2-55915PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Nuclear Factor Erythroid 2 Related Factor 1 Recombinant Protein Antigen (NBP2-55915PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Nuclear Factor Erythroid 2 Related Factor 1 Products

Research Areas for Nuclear Factor Erythroid 2 Related Factor 1 Recombinant Protein Antigen (NBP2-55915PEP)

Find related products by research area.

Blogs on Nuclear Factor Erythroid 2 Related Factor 1

There are no specific blogs for Nuclear Factor Erythroid 2 Related Factor 1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Nuclear Factor Erythroid 2 Related Factor 1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NFE2L1