NTN4 Antibody

Images

 
Immunohistochemistry-Paraffin: NTN4 Antibody [NBP2-13680] Staining of human kidney shows moderate membranous positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NTN4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AGVSSRCEKACNPRMGNLALGRKLWADTTCGQNATELYCFYSENTDLTCR QPKCDKCNAAYPHLAHLPSAMADSSFRFPRTWWQSAEDVHRE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NTN4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NTN4 Protein (NBP2-13680PEP)
Publications
Read Publication using
NBP2-13680 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NTN4 Antibody

  • beta-netrin
  • FLJ23180
  • hepar-derived netrin-like protein
  • netrin 4
  • PRO3091

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1006
Species: Rt
Applications: WB, IHC
AF1079
Species: Hu, Mu
Applications: WB, Simple Western, IHC, Block
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF844
Species: Mu
Applications: WB, Block
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB300-619
Species: Hu, Mu, Rt, Bv, Ch, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF1005
Species: Hu
Applications: WB, IHC
AF3629
Species: Hu, Mu, Rt
Applications: WB, Neut
AF1405
Species: Rt
Applications: WB, Block, ICC
AF1334
Species: Hu
Applications: WB, IHC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
AF2830
Species: Hu
Applications: WB
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-13680
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for NTN4 Antibody (NBP2-13680)(1)

We have publications tested in 1 confirmed species: Chicken.

We have publications tested in 2 applications: ICC/IF, IHC.


Filter By Application
ICC/IF
(1)
IHC
(1)
All Applications
Filter By Species
Chicken
(1)
All Species

Reviews for NTN4 Antibody (NBP2-13680) (0)

There are no reviews for NTN4 Antibody (NBP2-13680). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NTN4 Antibody (NBP2-13680) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NTN4 Products

Bioinformatics Tool for NTN4 Antibody (NBP2-13680)

Discover related pathways, diseases and genes to NTN4 Antibody (NBP2-13680). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NTN4 Antibody (NBP2-13680)

Discover more about diseases related to NTN4 Antibody (NBP2-13680).
 

Pathways for NTN4 Antibody (NBP2-13680)

View related products by pathway.

PTMs for NTN4 Antibody (NBP2-13680)

Learn more about PTMs related to NTN4 Antibody (NBP2-13680).

Blogs on NTN4

There are no specific blogs for NTN4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NTN4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NTN4