NTN4 Antibody


Western Blot: NTN4 Antibody [NBP1-91343] - Suggested Antibody Titration: 0.2-1 ug/ml Positive Control: MCF7 cell lysate
Immunohistochemistry-Paraffin: NTN4 Antibody [NBP1-91343] - rat and mouse brain, 10 ug/ml. Observed staining in cytoplasmin neurons

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

NTN4 Antibody Summary

Synthetic peptide directed towards the N terminal of human NTN4. Peptide sequence EDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDFGKTWKPYKY.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:1000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against NTN4 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NTN4 Antibody

  • beta-netrin
  • FLJ23180
  • hepar-derived netrin-like protein
  • netrin 4
  • PRO3091


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, Simple Western, IHC, Block
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, Block
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt, Bv, Ch, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Rt
Applications: WB, Block, ICC
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for NTN4 Antibody (NBP1-91343) (0)

There are no publications for NTN4 Antibody (NBP1-91343).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NTN4 Antibody (NBP1-91343) (0)

There are no reviews for NTN4 Antibody (NBP1-91343). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NTN4 Antibody (NBP1-91343) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional NTN4 Products

Bioinformatics Tool for NTN4 Antibody (NBP1-91343)

Discover related pathways, diseases and genes to NTN4 Antibody (NBP1-91343). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NTN4 Antibody (NBP1-91343)

Discover more about diseases related to NTN4 Antibody (NBP1-91343).

Pathways for NTN4 Antibody (NBP1-91343)

View related products by pathway.

PTMs for NTN4 Antibody (NBP1-91343)

Learn more about PTMs related to NTN4 Antibody (NBP1-91343).

Blogs on NTN4

There are no specific blogs for NTN4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NTN4 Antibody and receive a gift card or discount.


Gene Symbol NTN4