NT2NL Antibody (2G12-2A5) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related NT2NL Primary Antibodies

Order Details


    • Catalog Number
      H00388677-M01PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

NT2NL Antibody (2G12-2A5) [PE] Summary

Immunogen
NOTCH2NL (AAH19835, 1 a.a. ~ 237 a.a) full length recombinant protein with GST tag.MCVTYHNGTGYCKCPEGFLGEYCQHRDPCEKNRCQNGGTCVA QAMLGKATCRCASGFTGEDCQYSTSHPCFVSRPCLNGGTCHM LSRDTYECTCQVGFTGKECQWTDACLSHPCANGSTCTTVANQ FSCKCLTGFTGQKCETDVNECDIPGHCQHGGICLNLPGSYQC QCLQGFTGQYCDSLYVPCAPSPCVNGGTCRQTGDFTFECNCL PETVRRGTELWERDREVWNGKEHDEN
Specificity
NOTCH2NL - Notch homolog 2 (Drosophila) N-terminal like
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NOTCH2NL
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Reactivity Notes

Other species not tested.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NT2NL Antibody (2G12-2A5) [PE]

  • FLJ35032
  • FLJ55807
  • N2NNotch homolog 2 (Drosophila) N-terminal like
  • notch 2 N-terminal like
  • Notch homolog 2 N-terminal like protein
  • notch homolog 2 N-terminal-like protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
AF1190
Species: Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
H00388677-M01PE
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for NT2NL Antibody (H00388677-M01PE) (0)

There are no publications for NT2NL Antibody (H00388677-M01PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NT2NL Antibody (H00388677-M01PE) (0)

There are no reviews for NT2NL Antibody (H00388677-M01PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NT2NL Antibody (H00388677-M01PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NT2NL Products

Bioinformatics Tool for NT2NL Antibody (H00388677-M01PE)

Discover related pathways, diseases and genes to NT2NL Antibody (H00388677-M01PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for NT2NL Antibody (H00388677-M01PE)

Find related products by research area.

Blogs on NT2NL

There are no specific blogs for NT2NL, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NT2NL Antibody (2G12-2A5) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol NOTCH2NL