NSUN5 Antibody

Images

 
Western Blot: NSUN5 Antibody [NBP2-87948] - Host: Rabbit. Target Name: NSUN5. Sample Tissue: Human Jurkat Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NSUN5 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human NSUN5. Peptide sequence: SRPGPASQLPRFVRVNTLKTCSDDVVDYFKRQGFSYQGRASSLDDLRALK The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
NSUN5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NSUN5 Antibody

  • EC 2.1.1.-
  • FLJ10267
  • member 5A
  • MGC986
  • NOL1
  • NOL1/NOP2/Sun domain family member 5
  • NOL1/NOP2/Sun domain family, member 5
  • NOL1R(NOL1)
  • NOL1-related protein
  • NOP2/Sun domain family, member 5
  • NSUN5A
  • p120
  • putative methyltransferase NSUN5
  • WBSCR20
  • WBSCR20A
  • Williams-Beuren syndrome chromosomal region 20A protein
  • Williams-Beuren syndrome critical region protein 20 copy A
  • Ynl022cL

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF748
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP2-45646
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-54467
Species: Ch, Av-Du, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP1-92192
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-15723
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-45646
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF5094
Species: Hu, Mu, Rt
Applications: WB
H00001523-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
236-EG
Species: Hu
Applications: BA
H00008878-M01
Species: Bv, Ha, Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-37574
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
DRT100
Species: Hu
Applications: ELISA
NBP1-48309
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP1-88650
Species: Hu
Applications: IHC, IHC-P, KD, WB
NBP1-80905
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1002
Species: Mu
Applications: IHC, Simple Western, WB
NBP1-54467
Species: Ch, Av-Du, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP2-87948
Species: Hu
Applications: WB

Publications for NSUN5 Antibody (NBP2-87948) (0)

There are no publications for NSUN5 Antibody (NBP2-87948).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NSUN5 Antibody (NBP2-87948) (0)

There are no reviews for NSUN5 Antibody (NBP2-87948). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NSUN5 Antibody (NBP2-87948) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NSUN5 Products

Bioinformatics Tool for NSUN5 Antibody (NBP2-87948)

Discover related pathways, diseases and genes to NSUN5 Antibody (NBP2-87948). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NSUN5 Antibody (NBP2-87948)

Discover more about diseases related to NSUN5 Antibody (NBP2-87948).
 

Pathways for NSUN5 Antibody (NBP2-87948)

View related products by pathway.

Research Areas for NSUN5 Antibody (NBP2-87948)

Find related products by research area.

Blogs on NSUN5

There are no specific blogs for NSUN5, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NSUN5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NSUN5