Home » NSUN5 » NSUN5 Antibodies » NSUN5 Antibody

NSUN5 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: NSUN5 Antibody [NBP2-87948] - Host: Rabbit. Target Name: NSUN5. Sample Tissue: Human Jurkat Whole Cell lysates. Antibody Dilution: 1ug/ml
Western Blot: NSUN5 Antibody [NBP2-87948] - Host: Rabbit. Target Name: NSUN5. Sample Tissue: Human Jurkat Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

NSUN5 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human NSUN5. Peptide sequence: SRPGPASQLPRFVRVNTLKTCSDDVVDYFKRQGFSYQGRASSLDDLRALK The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
NSUN5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NSUN5 Antibody

  • EC 2.1.1.-
  • FLJ10267
  • member 5A
  • MGC986
  • NOL1
  • NOL1/NOP2/Sun domain family member 5
  • NOL1/NOP2/Sun domain family, member 5
  • NOL1R(NOL1)
  • NOL1-related protein
  • NOP2/Sun domain family, member 5
  • NSUN5A
  • p120
  • putative methyltransferase NSUN5
  • WBSCR20
  • WBSCR20A
  • Williams-Beuren syndrome chromosomal region 20A protein
  • Williams-Beuren syndrome critical region protein 20 copy A
  • Ynl022cL

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

E-Cadherin
Antibody [Unconjugate
AF748
E‑Cadherin was detected in immersion fixed D3 mouse embryonic stem cell line using Goat Anti-Human/MouseE‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF748) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces. View our protocol for Fluorescent ICC Staining of Stem Cells on Coverslips.
E‑Cadherin was detected in perfusion fixed frozen sections of mouse skin using Goat Anti-Human/Mouse E‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF748) at 1.7 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to plasma membranes in keratinocytes. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
E‑Cadherin was detected in immersion fixed mouse intestinal organoids using Goat Anti-Human/Mouse E‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF748) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (green; Catalog # NL001) and counterstained with DAPI (blue). Magnification shown at 100X (upper panel) and 40X (lower panel). Specific staining was localized to cell surfaces. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(10 Reviews)
(43 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
p120-catenin
Antibody (OTI2E8)
NBP2-45646
Immunohistochemistry: p120-catenin Antibody (2E8) [NBP2-45646] - Analysis of Carcinoma of Human kidney tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Immunohistochemistry: p120-catenin Antibody (2E8) [NBP2-45646] - Analysis of Carcinoma of Human prostate tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Immunohistochemistry: p120-catenin Antibody (2E8) [NBP2-45646] - Analysis of Human colon tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
beta-Catenin
Antibody (12F7) - BSA
NBP1-54467
Flow Cytometry: beta-Catenin Antibody (12F7) [NBP1-54467] - An intracellular stain was performed on SK-MEL-28 cells with beta-Catenin Antibody [12F7] NBP1-54467B (blue) and a matched isotype control (orange). Both antibodies were conjugated to Biotin. Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Streptavidin - R-Phycoerythrin Protein (2012-1000, Novus Biologicals).
Western Blot: beta-Catenin Antibody (12F7) [NBP1-54467] - Analysis of beta Catenin expression in 1) HepG2, 2) MCF7, and 3) Cos7 whole cell lysates using NBP1-54467.
Immunohistochemistry: beta-Catenin Antibody (12F7) [NBP1-54467] - IF beta-Catenin staining of mouse brain tissue. This image submitted by a verified customer review.
(4 Reviews)
(15 Publications)
Species: Ch, Av-Du, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NOL1 Antibody
NBP1-92192
Immunohistochemistry-Paraffin: NOL1 Antibody [NBP1-92192] - Staining of human skin shows distinct nucleolar positivity in keratinocytes.
Western Blot: NOL1 Antibody [NBP1-92192] - Analysis in human cell line NTERA-2.
Western Blot: NOL1 Antibody [NBP1-92192] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western blot shows lysates of MDA‑MB‑468 human breast cancer cell line and HepG2 human hepatocellular carcinoma cell line untreated (-) or treated (+) with 50 μM pervanadate (PV) for 10 minutes. PVDF membrane was probed with 1 µg/mL of Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Src (Y419) at approximately 56 - 61 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MBA‑MB‑468 human breast cancer cell line untreated (-) or treated (+) with 50 µM Pervanadate (PV) for 10 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Src (Y419) at approximately 64 kDa (as indicated) using 10 µg/mL of Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Src phosphorylated at Y419 was detected in immersion fixed paraffin-embedded sections of human colon using Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Specific labeling was localized to the cytoplasm of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
(6 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
Catenin alpha 1
Antibody
NBP2-15723
Western Blot: Catenin alpha 1 Antibody [NBP2-15723] - Sample (30 ug of whole cell lysate) A: A431 B: Hela 7. 5% SDS PAGE gel, diluted at 1:1000.
Western Blot: Catenin alpha 1 Antibody [NBP2-15723] - Sample (50 ug of whole cell lysate) A: Mouse Brain, 7. 5% SDS PAGE gel, diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: Catenin alpha 1 Antibody [NBP2-15723] - Immunofluorescence analysis of methanol-fixed HeLa, using antibody at 1:500 dilution.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
p120-catenin
Antibody (OTI2E8)
NBP2-45646
Immunohistochemistry: p120-catenin Antibody (2E8) [NBP2-45646] - Analysis of Carcinoma of Human kidney tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Immunohistochemistry: p120-catenin Antibody (2E8) [NBP2-45646] - Analysis of Carcinoma of Human prostate tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Immunohistochemistry: p120-catenin Antibody (2E8) [NBP2-45646] - Analysis of Human colon tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Ras-GAP Antibody
AF5094
Western blot shows lysates of TT human medullary thyroid cancer cell line, C2C12 mouse myoblast cell line, and Rat‑2 rat embryonic fibroblast cell line. PVDF membrane was probed with 1 µg/mL of Human/Mouse/Rat Ras‑GAP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5094) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Ras‑GAP at approximately 120 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB
CDP/CUTL1 Antibody
(2A10)
H00001523-M01
Western Blot: CDP/CUTL1 Antibody (2A10) [H00001523-M01] - Analysis of CUX1 expression in transfected 293T cell line by CUTL1 monoclonal antibody (M01), clone 2A10.Lane 1: CUX1 transfected lysate(77.2 KDa).Lane 2: Non-transfected lysate.
Immunohistochemistry-Paraffin: CDP/CUTL1 Antibody (2A10) [H00001523-M01] - mouse cortex - postnatal brain was stained with anti-CUTL1 antibody. Image from verified customer review.
ELISA: CDP/CUTL1 Antibody (2A10) [H00001523-M01] - Detection limit for recombinant GST tagged CUTL1 is approximately 0.03ng/ml as a capture antibody.
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
ERK2 Antibody
(SZ25-01)
NBP2-67360
Flow Cytometry: ERK2 Antibody (SZ25-01) [NBP2-67360] - Analysis of Hela cells with ERK2 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: ERK2 Antibody (SZ25-01) [NBP2-67360] - Staining ERK2 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: ERK2 Antibody (SZ25-01) [NBP2-67360] - Staining ERK2 in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
EGF [Unconjugated]
236-EG
1 µg/lane of Recombinant Human EGF was resolved with SDS-PAGE  and visualized by silver staining under reducing (R) conditions, showing a single band at 6 kDa.
Recombinant Human EGF (Catalog # 236‑EG) stimulates cell proliferation of the Balb/3T3 mouse embryonic fibroblast cell line. The ED50 for this effect is 20‑100 pg/mL.
(27 Reviews)
(588 Publications)
Species: Hu
Applications: BA
p62/SQSTM1
Antibody (2C11)
H00008878-M01
Immunocytochemistry/Immunofluorescence: p62/SQSTM1 Antibody (2C11) [H00008878-M01] - Analysis of p62 in SH-SY5Y cells using anti-p62/SQSTM1 antibody. Red - p62 puncta; Blue - nuclear DAPI; Green - Cytoskeleton. Image from verified customer review.
Western Blot: p62/SQSTM1 Antibody (2C11) [H00008878-M01] - Confirmation of loss of hepatic ATG7 protein and a phenotype of hepatic autophagy inactivation. Fourth ug of liver protein were loaded on 4-20% gradient Tris-Glycine gels and subsequently immunoblotted with antibodies against ATG7, p62 and LC3. Blots were visualized with G:BOX Chemi XRQ (SynGene). Representative immunoblots are shown for WT and KO mice. Full-length immunoblots are presented in Supplementary Figure S1. ATG7: autophagy-related protein 7; p62: sequestosome 1; LC3: microtubule-associated protein 1 light chain 3; WT: Mx1-Cre-Atg7F/F mouse; KO: Mx1-Cre+Atg7F/F mouse. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-017-14405-w), licensed under a CC-BY licence.
Western Blot: p62/SQSTM1 Antibody (2C11) [H00008878-M01] - Disruption of the VANGL2-p62/SQSTM1 interaction in breast cancer cells. Soft agar colony formation of T47D cells overexpressing GFP, GFP-VANGL2 and GFP-p62/SQSTM1 (right). Protein expression was revealed with anti-p62/SQSTM1, anti-VANGL2 and anti-GFP antibodies by western blot analysis (right). In anti-GFP blot, the arrowhead indicates position of co-migrating GFP-VANGL2 and GFP-p62/SQSTM1 and the asterisk pinpoints GFP alone. Error bars represent mean+/-s.d. (n=3). Image collected and cropped by CiteAb from the following publication (http://www.nature.com/doifinder/10.1038/ncomms10318), licensed under a CC-BY licence.
(9 Reviews)
(256 Publications)
Species: Bv, Ha, Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
CBL Antibody (3B12)
NBP2-37574
ELISA: CBL Antibody (3B12) [NBP2-37574] - Red: Control Antigen (100ng); Purple: Antigen (10ng); Green: Antigen (50ng); Blue: Antigen (100ng);
Western Blot: CBL Antibody (3B12) [NBP2-37574] - Western blot analysis using C-CBL mAb against human C-CBL (AA: 684-865) recombinant protein. (Expected MW is 44.9 kDa)
Western Blot: CBL Antibody (3B12) [NBP2-37574] - Western blot analysis using C-CBL mouse mAb against RAJI (1), RAW264.7 (2), K562 (3), SKBR-3 (4), 3T3-L1 (5), THP-1 (6) and PC-12 (7) cell lysate.
(1 Review)
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
TNF RI/TNFRSF1A
[HRP]
DRT100
(2 Reviews)
(78 Publications)
Species: Hu
Applications: ELISA
N-Cadherin
Antibody (13A9)
NBP1-48309
Flow (Intracellular): N-Cadherin Antibody (13A9) [NBP1-48309] - An intracellular stain was performed on HeLa with NBP1-48309 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Mouse F(ab)2 IgG (H+L) PE-conjugated Antibody.
Flow Cytometry: N-Cadherin Antibody (13A9) [NBP1-48309] - An intracellular stain was performed on HeLa cells with NBP1-48309AF488 and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Immunocytochemistry/Immunofluorescence: N-Cadherin Antibody (13A9) [NBP1-48309] - HEK 293 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton X-100. The cells were incubated with anti- at 5 ug/mL overnight at 4C and detected with an anti-mouse DyLight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
(2 Reviews)
(37 Publications)
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
ARHGEF7 Antibody
NBP1-88650
Western Blot: ARHGEF7 Antibody [NBP1-88650] - Analysis in human cell line SH-SY5Y.
Immunohistochemistry-Paraffin: ARHGEF7 Antibody [NBP1-88650] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ARHGEF7 Antibody [NBP1-88650] - Staining of human cerebral cortex shows weak to moderate cytoplasmic positivity in neurons.
Species: Hu
Applications: IHC, IHC-P, KD, WB
GLTSCR2 Antibody
NBP1-80905
Immunohistochemistry-Paraffin: GLTSCR2 Antibody [NBP1-80905] - Staining of human hippocampus shows strong nucleolar positivity in neuronal cells.
Immunocytochemistry/Immunofluorescence: GLTSCR2 Antibody [NBP1-80905] - Staining of human cell line U-2 OS shows positivity in nucleoli and vesicles. Antibody staining shown in green.
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
VE-Cadherin
Antibody [Unconjugate
AF1002
VE‑Cadherin was detected in immersion fixed paraffin-embedded sections of mouse heart using Goat Anti-Mouse VE‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1002) at 3 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cell membranes. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
Western blot shows lysates of mouse lung tissue and bEnd.3 mouse endothelioma cell line. PVDF membrane was probed with 0.2 µg/mL of Goat Anti-Mouse VE‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1002) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for VE‑Cadherin at approximately 120 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of mouse lung tissue, loaded at 0.2 mg/mL. Specific bands were detected for VE‑Cadherin at approximately 118, 146 kDa (as indicated) using 10 µg/mL of Goat Anti-Mouse VE‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1002) . This experiment was conducted under reducing conditions and using the 12‑230 kDa separation system.        
(4 Reviews)
(51 Publications)
Species: Mu
Applications: IHC, Simple Western, WB
beta-Catenin
Antibody (12F7) - BSA
NBP1-54467
Flow Cytometry: beta-Catenin Antibody (12F7) [NBP1-54467] - An intracellular stain was performed on SK-MEL-28 cells with beta-Catenin Antibody [12F7] NBP1-54467B (blue) and a matched isotype control (orange). Both antibodies were conjugated to Biotin. Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Streptavidin - R-Phycoerythrin Protein (2012-1000, Novus Biologicals).
Western Blot: beta-Catenin Antibody (12F7) [NBP1-54467] - Analysis of beta Catenin expression in 1) HepG2, 2) MCF7, and 3) Cos7 whole cell lysates using NBP1-54467.
Immunohistochemistry: beta-Catenin Antibody (12F7) [NBP1-54467] - IF beta-Catenin staining of mouse brain tissue. This image submitted by a verified customer review.
(4 Reviews)
(15 Publications)
Species: Ch, Av-Du, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NSUN5 Antibody
NBP2-87948
NSUN5 Antibody
Species: Hu
Applications: WB

Publications for NSUN5 Antibody (NBP2-87948) (0)

There are no publications for NSUN5 Antibody (NBP2-87948).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NSUN5 Antibody (NBP2-87948) (0)

There are no reviews for NSUN5 Antibody (NBP2-87948). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NSUN5 Antibody (NBP2-87948) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NSUN5 Products

Bioinformatics Tool for NSUN5 Antibody (NBP2-87948)

Discover related pathways, diseases and genes to NSUN5 Antibody (NBP2-87948). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NSUN5 Antibody (NBP2-87948)

Discover more about diseases related to NSUN5 Antibody (NBP2-87948).
 

Pathways for NSUN5 Antibody (NBP2-87948)

View related products by pathway.

Research Areas for NSUN5 Antibody (NBP2-87948)

Find related products by research area.

Blogs on NSUN5

There are no specific blogs for NSUN5, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NSUN5 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol NSUN5