NSDHL Antibody

Images

 
Independent Antibodies: Western Blot: NSDHL Antibody [NBP1-83306] - Analysis using Anti-NSDHL antibody NBP1-83306 (A) shows similar pattern to independent antibody NBP1-83307 (B).
Immunocytochemistry/ Immunofluorescence: NSDHL Antibody [NBP1-83306] - Staining of human cell line A-431 shows localization to endoplasmic reticulum & lipid droplets. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NSDHL Antibody [NBP1-83306] - Staining of human testis using Anti-NSDHL antibody.
Western Blot: NSDHL Antibody [NBP1-83306] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells). Lane 3: PC12 cell lysate (Pheochromocytoma of rat ...read more
Immunohistochemistry-Paraffin: NSDHL Antibody [NBP1-83306] - Staining of human epididymis shows high expression.
Immunohistochemistry-Paraffin: NSDHL Antibody [NBP1-83306] - Staining of human lymph node shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: NSDHL Antibody [NBP1-83306] - Staining in human epididymis and lymph node tissues using anti-NSDHL antibody. Corresponding NSDHL RNA-seq data are presented ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: NSDHL Antibody [NBP1-83306] - Staining of human cerebral cortex, epididymis, lymph node and testis using Anti-NSDHL antibody NBP1-83306 (A) shows similar ...read more
Immunohistochemistry-Paraffin: NSDHL Antibody [NBP1-83306] - Staining of human cerebral cortex using Anti-NSDHL antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NSDHL Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LPYAMKPIDYYTETKILQERAVLGANDPEKNFLTTAIRPHGIFGPRDPQLVPILIEAARNGKMKFVIGNGKNLVDFTFVENVVHGHILAAEQLSRDSTLGGKAFHITNDEPIPFWTFLSRI
Specificity
Specificity of human, mouse, rat NSDHL antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NSDHL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control
NSDHL Knockout 293T Cell Lysate
Control Peptide
NSDHL Protein (NBP1-83306PEP)
Publications
Read Publications using NBP1-83306.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NSDHL Antibody

  • EC 1.1.1.170
  • H105e3
  • member 1
  • NAD(P) dependent steroid dehydrogenase-like
  • SDR31E1
  • sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating
  • XAP104

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89946
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85699
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-74267
Species: Hu
Applications: WB
NBP1-92450
Species: Hu
Applications: IHC, IHC-P
H00152503-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
NBP1-89560
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16463
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-33050
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF8516
Species: Hu
Applications: WB, Simple Western, IP, ICC
H00001717-D01P
Species: Hu, Mu, Rt
Applications: WB
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, RIA
NBP2-66888
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IP
NBP1-31477
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24716
Species: Hu, Mu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32005
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-54446
Species: Hu, Ch
Applications: WB, ELISA, GS, ICC/IF, IP

Publications for NSDHL Antibody (NBP1-83306)(2)

Reviews for NSDHL Antibody (NBP1-83306) (0)

There are no reviews for NSDHL Antibody (NBP1-83306). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NSDHL Antibody (NBP1-83306) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NSDHL Products

Bioinformatics Tool for NSDHL Antibody (NBP1-83306)

Discover related pathways, diseases and genes to NSDHL Antibody (NBP1-83306). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NSDHL Antibody (NBP1-83306)

Discover more about diseases related to NSDHL Antibody (NBP1-83306).
 

Pathways for NSDHL Antibody (NBP1-83306)

View related products by pathway.

PTMs for NSDHL Antibody (NBP1-83306)

Learn more about PTMs related to NSDHL Antibody (NBP1-83306).

Blogs on NSDHL

There are no specific blogs for NSDHL, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NSDHL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NSDHL